KEGG   Hipposideros armiger (great roundleaf bat): 109387149
Entry
109387149         CDS       T04661                                 

Gene name
CIITA
Definition
(RefSeq) class II major histocompatibility complex transactivator
  KO
K08060  MHC class II transactivator [EC:2.7.11.1]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04612  Antigen processing and presentation
hai05145  Toxoplasmosis
hai05152  Tuberculosis
hai05164  Influenza A
hai05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:hai00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    109387149 (CIITA)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    109387149 (CIITA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109387149 (CIITA)
  09172 Infectious disease: viral
   05164 Influenza A
    109387149 (CIITA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109387149 (CIITA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109387149 (CIITA)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hai04054]
    109387149 (CIITA)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109387149 (CIITA)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: Other
  TAF1 family
   109387149 (CIITA)
Pattern recognition receptors [BR:hai04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   109387149 (CIITA)
SSDB
Motif
Pfam: NACHT LRR_6 NLRC4_HD2 LRR_4 LRR_8 CARD LRR_9 AAA_16
Other DBs
NCBI-GeneID: 109387149
NCBI-ProteinID: XP_019506415
LinkDB
Position
Un
AA seq 1202 aa
MNHFQTQIRMLLSSHQPSQVQDNLLEEELLSREYHCALLQEPDGEALARKILTLLQKGDP
DLALLECAWSGLQAPASEKDLGSKDDGGSEQCAAMELGPLEGSYLELLNSNADPSQIYLY
YDQMDPAGEESELCSEPDTDTINYEQFSRLLCDINDDEETRDAYANIAELDQYVFQDSQF
EGLSKDIFIDHIELEEIISESVEMLEEAGQKRKKRSFPEELPADLKHRKLAEPIAVPMTT
GTFLVEPASGPMALPCLSPPTLFDKDLASSQTQLEETTLKPAPPSGSLLSCLSLPAGPFQ
IIPTLSTLPQGFWQISGAGTGVSSILIYQGEMPQTSQAPPSSSPAVHSLPKSLERPGSTS
PFAPSAADLPSMPEPALTSRANTIEDEVSSTQCLAAPEVSSKLPKWPDSVEQFCRSLRDK
YQAEPAGPEGVLVEVDLVRTRLERISIKSQERELANLDWAERQPARAGLAEVLLAASDRR
RPRETQVIAVLGKAGQGKSRWARAVSRAWACGQLPQYDFVFYLPCHCLDRPGDAYRLQDL
LFSLGPQPLPVDSEVFGHILRRPERVLLILDTFEELEAQDGLLHNACRPASAEPRSLRGL
LAGLLQRKLLRGCTLLLTARSRSRLAQSLSKADALFEMPGFSAEQAKTYVRSYFERSGAA
HHQERALELLQGQPLLLSHSHSPTVCLAVCQLSEALLELEKKAELPSTLTGLYVGLLGPA
ARDSPPGALEALARLAWELGRRHQSTLREGQFPSEEVRAWAVARGWVQPVPGAPEKELAF
PSFLLQCFLGAVWLALSSEIKDKELPQYLALTPRKKRPYDNWLDGVPRFLAGLVFQPRAR
CLGALAGPVALTLVNRKQKVLTRYLKRLQPGTLQAGRLLELLHCAHEALDAGLKQHVVQG
LPASLSFLGTRLTPPDTHVLGSTLQAAGREFFLDLRRTGIDPSGLGSLVGLSCVTHFRAA
LSDTVELWESLRQRGEAKLLQAVEDKFTIEPFKAKSVKDVEDLGNLVQIQRTTSSSEDTA
RELPAVRDLKKLEFALGPVMGPQAFPKLVRILEAFSSLQHLDLDSLSENKIGDEGVALLS
ATFPQLKALETLNLSQNSITDVGACKLAKALPSLASSLLRLSLYNNCICDLGAESLANVL
PDMVSLRVLDVQYNKFTAAGAQQLTASLRKCPHVETLAMWTPTIPFGVQEHLQQLDSRIS
LR
NT seq 3609 nt   +upstreamnt  +downstreamnt
atgaaccacttccagactcagatccggatgctgctgtccagccatcagccgagccaggta
caggacaacctgctggaggaagagcttctgtccagggagtaccactgcgccctgctccag
gaacctgatggtgaggctctggccaggaagatcttgaccctgctgcagaaaggagacccg
gacttggccctcttggagtgtgcctggagtgggctgcaggccccagcatctgagaaggac
ctcggctccaaggatgatggtggcagtgaacagtgtgccgccatggagttggggcctctg
gaaggcagttacctggagcttcttaacagcaatgctgacccttcgcagatctacctctac
tatgaccagatggacccggctggggaagagagcgaactctgctcagaacccgacacagac
accatcaactatgaacagttcagcaggctgctgtgtgacataaatgatgatgaagagacc
agggacgcctatgccaatatcgccgaactggaccagtacgtgttccaggactcccagttc
gagggcctgagcaaagacattttcatcgaccacatagaattggaagaaataatcagcgag
agtgtggagatgctggaggaagcaggacaaaaaaggaaaaaaagatccttccccgaggag
ctgcctgcggacctgaagcacaggaagctcgccgagcccatcgctgtgcccatgacgact
ggcactttcctagtggagccagcgagtggccccatggctctgccctgcctgtcaccacct
actctgttcgacaaggatctagcatccagccagacccagctggaggaaaccaccctaaaa
cctgcgcccccctccgggtccttgttgagctgcctgagtctcccggctggacctttccag
atcatccccactctctccactctgccccagggattctggcagatctcaggagctgggacc
ggggtctccagtatactcatctaccaaggtgagatgccccagaccagccaagcgccccca
tccagcagcccagctgtccacagcctcccgaagtcccttgagcggcccggctccaccagc
cccttcgccccatccgcagctgaccttcccagcatgccagaaccagccctgacgtcccgt
gcaaacacgatagaggatgaggtgtcctccacccaatgcctggcagctcccgaggtctcc
agcaagcttccaaaatggcctgacagtgtggagcagttctgccgctccctacgggacaag
taccaggccgagcccgcgggcccggaaggcgtcctggtggaggtggacctggtgaggacc
cggctggagaggatcagcatcaagagccaggagagggagctggccaacctggactgggcg
gagcggcagccagcccgcgcgggtctggccgaggtgctgctggctgctagtgaccggcgg
cggccacgtgaaacgcaggtgattgccgtgctgggcaaggcaggacaggggaagagccgt
tgggcccgggcagtgagccgggcctgggcctgcggccagctgccgcagtacgacttcgtc
ttctacttgccctgccactgtttggaccgtccgggggacgcctaccgcctgcaggacctc
ctgttctccctgggcccacagccactgccggtggacagcgaggtcttcggtcacatcttg
aggaggcccgagcgcgtcctgctcatcctggacaccttcgaggagctcgaagcccaagac
ggcctcctgcacaacgcatgcagacccgcgtcggcggaaccccgctctctccgggggctg
ctggccggcctcctccaacgcaaactgctgcgaggctgcactctgctgctcacagcccgg
tcccggagtcgcctggcccagagcctgagcaaggccgacgccctgttcgagatgcctggc
ttctccgctgagcaggccaagacctatgtgaggagctacttcgagcggtcgggggccgct
caccaccaagagagagccctggagctcctccagggccagccgcttctcctcagtcacagc
cacagccccactgtgtgcctggccgtgtgccagctctccgaggccctcctggagctggaa
aagaaggccgagctgccctccacactcacgggactgtacgttggcctactaggcccagca
gcccgtgacagccccccaggggccctggaggcgctggccaggctggcgtgggagctgggc
cgcagacaccagagcaccctgcgggaaggccagtttccatcggaagaggtgagggcctgg
gctgtggccagaggctgggtgcagcccgtccccggggccccagagaaggagctggccttc
cctagcttcctcctgcagtgcttcctgggggctgtgtggctggctctgagcagtgagatc
aaggacaaggagctgccacaatatttggcattgaccccgaggaagaagaggccctatgac
aactggctggatggcgtgccgcgctttctggccgggctggtcttccagcctcgcgcccgc
tgcctgggagccctggcagggccagtggcgctcaccttggtgaacaggaagcagaaggta
ctcaccaggtacctgaagcggctgcagccgggaacactgcaggcagggcggctgctggag
ctgctgcactgtgcccacgaggcgttggacgctggccttaagcagcatgtggtacagggg
ctccccgccagcctatccttcctgggcacccgactcacgcctccggacacccatgtgctg
ggcagcaccctgcaggcggcgggccgcgaattcttcctggacctccgtcgcactggcatt
gacccctctggactggggagcctcgtgggactcagctgtgtcacccatttcagggccgcc
ttgagtgacacggtggagctgtgggagtctctacgacagcgtggggaggccaagctactc
caggcggtggaagacaagttcaccattgagcctttcaaggccaagtccgtgaaggatgtg
gaagacctgggcaaccttgtgcagatccagaggacaacaagttcctcagaagacacagcc
agggaactgcccgctgtccgggacctaaagaagctagagtttgcgctgggccctgtcatg
ggcccccaggctttccccaaactggtgaggatcctcgaggccttttcatcccttcagcat
ctggacctggactcgctgagcgagaacaagattggggacgagggtgtcgcgctgctctca
gccaccttccctcagctgaaagccctggagacactgaatttgtctcagaacagcatcacc
gacgtgggcgcctgcaagctcgctaaggccctgccctccttggcttcgtccctccttagg
ctgagcttgtacaataactgcatctgtgacctgggagctgagagcctggcaaacgtgctt
ccagacatggtgtccctgcgggtcctggatgtccagtacaacaagttcacggccgccggg
gcccagcagctcaccgccagcctgagaaagtgccctcatgtggagacccttgcgatgtgg
acacccaccattccatttggcgtccaggaacacctacagcagctggactctcggatcagc
ctgagatga

DBGET integrated database retrieval system