KEGG   Hipposideros armiger (great roundleaf bat): 109387359
Entry
109387359         CDS       T04661                                 

Gene name
TLR7
Definition
(RefSeq) toll like receptor 7
  KO
K05404  toll-like receptor 7
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04620  Toll-like receptor signaling pathway
hai05162  Measles
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109387359 (TLR7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    109387359 (TLR7)
   05164 Influenza A
    109387359 (TLR7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hai04054]
    109387359 (TLR7)
Pattern recognition receptors [BR:hai04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   109387359 (TLR7)
SSDB
Motif
Pfam: LRR_8 LRR_4 TIR LRR_5 LRR_12 LRR_1 TIR_2 LRR_9
Other DBs
NCBI-GeneID: 109387359
NCBI-ProteinID: XP_019506734
UniProt: A0A1L6KUM7
LinkDB
Position
Un
AA seq 1049 aa
MVFPMWTLKKQFLILFNMILISKLGARWFPKTLPCDVSQDDLKTQVIVDCTDKHLTEIPG
GIPTNATNLTLTINHIPGISPASFHQLDQLVEIDFRCNCVPIRLGPKDNMCTKRLQIKLG
SFSRLTSLKSLYLDGNQLLEIPLGLPSSLRLLSLEANNIFSIKKENLTELDNIEKLYLGQ
NCYYRNPCNVSFFIEKDAFQNLLNLKLLSLKDNNITAVPTVLPPTLTELYLYNNIIANIY
EHDFSNLSQLQILDLSGNCPRCYNVPFPCTPCKNNSALQIHLNAFDALTELQVLRLHSNS
LQSVPQRWFRNITKLKELDLSQNYLAKEIGDAKFLHLLHNLVQLDLSFNYELQVYHAFMN
LSSAFSSLKNLKVLRIKGYVFKELQFYNLSPLHNLSNLEVLDLGTNFIKIANLSIFKQFK
TLKVIDLSMNKISPSGDSSEAGFCSNTRTSVVAHGTQVLESLHYFRYDEYARSCRYKNKE
TPSVLHFNEECYVYGQTLDLSRNNIFFIKSSDFHHLSFLKCLNLSGNTIGQTLNGSEFQP
LVELKYLDFSNNRLDLLYSTAFDELRELEVLDISSNSHYFQSEGITHMLNFTKNLKVLKK
LMMNNNDISTSTSTTMESESLKILEFRGNHLDILWRDGDSRYFKFFKNLKNLEILDISAN
SLSFLPAGVFDGMPPNLKTLLLVKNGLKSFHWEKLPYLKNLETLDLSHNQLKTVPERLSN
CSSSLKKLILSNNQIRYLTKYFLQGAFQLRYLDLSSNKIQIIQKTSFPENVLNNLEMLLL
HHNRFLCTCDAVWFVWWVNHTEVTIPHLATDVTCVGPGAHKGQSVISLDLYTCELDLTNL
ILFSFTISAALFLMVVMTASHLYFWDVWYSYHFCKAKIKGYQRLISPESCYDAFIVYDTK
DPAVTEWVLDELVVKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQFSKKTVFVMTDK
YAKTENFKIAFYLSHQRLMDEKVDVIILIFLEKPLQKSKFLQLRKRLCGSSVLEWPTNPQ
AHPYFWQCLKNALATDNHVTYSRVFKETA
NT seq 3150 nt   +upstreamnt  +downstreamnt
atggtgttcccaatgtggacattgaagaaacaatttcttatcctttttaacatgatccta
atttccaaacttggggctagatggtttcctaaaactctgccctgtgatgtcagtcaggat
gatctaaagacccaagtgattgtggactgcacagacaagcatttgacagaaattcctgga
ggtattcccaccaacgccaccaacctcaccctcaccattaaccacataccgggcatctct
ccagcttccttccaccagctggaccagctggtagagatcgatttcagatgcaactgtgta
cctattcgcctggggccgaaagacaacatgtgcaccaagaggttgcagattaaactcgga
agttttagtagactcacttctttaaaatctctttacctggatggaaaccagcttctagaa
atacctctgggtcttccttccagcttacggctgctgagccttgaagccaacaacatcttt
tcgatcaagaaagagaatctaacagaattggacaacatagaaaaactgtacctcggccaa
aactgttattatcgcaatccttgcaatgtttcatttttcattgaaaaagatgctttccaa
aacttgctaaatttaaaattgctctctctgaaagataacaatatcacagctgtccccact
gttttgccacctactttgacagaactctatctttacaacaacatcattgcaaacatctat
gaacatgattttagtaacctcagtcaactgcaaattcttgacctaagtggaaactgccct
cgttgttataatgtgccatttccttgtacaccctgtaagaataattctgccctacagatc
catttaaacgcttttgacgcattgacagaattacaagttttgcgtctacacagcaactct
cttcagtcggtgccccaaagatggtttagaaacattaccaaacttaaggaactagatctt
tcccaaaactacttggcaaaagaaattggggatgccaaatttttgcatcttcttcacaac
cttgtccaactggatctgtctttcaattatgaacttcaggtctatcatgcatttatgaat
ctatcaagtgcattttcttcactgaaaaacctgaaagttttgcggatcaaaggatacgtc
tttaaggagctgcaattctataacctttccccattacataatctttccaatcttgaagtt
cttgatcttggcactaactttataaaaatcgctaacctcagcatatttaaacaatttaaa
acattgaaagtcatagatctttcaatgaataaaatatccccttcaggagattcaagtgaa
gctggcttctgttctaacaccagaacttctgtagtagcccatgggacccaggtccttgaa
tcattacattacttcagatatgatgagtatgcaaggagttgcaggtacaaaaacaaagag
actccttctgtcttgcattttaatgaagagtgttatgtgtatgggcagactttggaccta
agtagaaataatatattttttatcaagtcctctgattttcatcatctttctttcctcaaa
tgcctaaacttgtcaggaaataccattggccaaactcttaatggcagtgaatttcagcct
ttagtggagttgaaatacttggatttctctaacaaccggcttgatttactctactcaaca
gcatttgatgagctacgtgaactggaagttctagatataagtagtaacagccattatttt
caatcagaaggaattactcacatgctaaactttaccaagaacctcaaggttctcaagaaa
ctgatgatgaacaacaatgacatctctacttccaccagcacgaccatggagagcgaatct
cttaaaattctggaattcagaggaaatcatttggatattttatggagagatggtgatagc
agatactttaaattcttcaagaatctgaaaaacttagagatattagacatctctgcaaat
tccctgagtttcttgcctgctggagtttttgatggtatgcctccaaatctgaagaccctt
cttttggtcaaaaatgggctcaagtctttccattgggaaaaactcccgtatctgaagaat
ttagaaactttggacctcagccacaaccagctgaagaccgtccctgagagattatccaac
tgttccagcagcctcaagaaactaattcttagcaataatcaaatcaggtatctgacaaag
tattttctacaaggtgctttccagttgcggtatctggacctcagctcaaataaaatccag
attatccaaaagaccagctttccggaaaacgttctcaacaatctggagatgttacttttg
catcataatcggtttctgtgcacctgtgatgctgtgtggtttgtctggtgggttaaccat
acagaggtgaccattcctcacttggccacagatgtgacttgtgtggggccaggagcacac
aagggccaaagtgtgatctctctcgatctgtatacctgtgagttagatctgactaacttg
attctgttctcatttaccatatcggcagctctctttctgatggtggttatgacagcaagc
cacctctatttctgggatgtatggtatagttaccatttctgcaaggccaaaataaagggg
tatcaacgtctgatatcaccagaatcctgctatgatgcttttattgtgtatgacactaaa
gacccagcagtgacagagtgggttttggacgagctggtggtcaaattggaagacccaaga
gagaaacattttaatttatgtcttgaggaaagggactggttaccagggcagccggttctg
gaaaacctttcccagagcatacagtttagcaagaagacggtgtttgtgatgacagacaag
tatgcaaagactgagaattttaagatagcattttacttgtcccatcagaggctcatggat
gaaaaagtggatgtaattatcttaatattccttgagaagcccctccagaagtccaagttc
ctccagctccgaaagaggctctgtgggagttctgttcttgagtggccaacaaacccacag
gctcatccgtacttctggcagtgtctgaaaaatgccctggccacagacaatcatgtgacc
tacagccgggtgttcaaagagacagcctag

DBGET integrated database retrieval system