KEGG   Hipposideros armiger (great roundleaf bat): 109387785
Entry
109387785         CDS       T04661                                 

Gene name
IGF1
Definition
(RefSeq) insulin like growth factor 1
  KO
K05459  insulin-like growth factor 1
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai04010  MAPK signaling pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04066  HIF-1 signaling pathway
hai04068  FoxO signaling pathway
hai04114  Oocyte meiosis
hai04115  p53 signaling pathway
hai04150  mTOR signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04152  AMPK signaling pathway
hai04211  Longevity regulating pathway
hai04213  Longevity regulating pathway - multiple species
hai04510  Focal adhesion
hai04550  Signaling pathways regulating pluripotency of stem cells
hai04730  Long-term depression
hai04750  Inflammatory mediator regulation of TRP channels
hai04913  Ovarian steroidogenesis
hai04914  Progesterone-mediated oocyte maturation
hai04935  Growth hormone synthesis, secretion and action
hai04960  Aldosterone-regulated sodium reabsorption
hai05200  Pathways in cancer
hai05202  Transcriptional misregulation in cancer
hai05205  Proteoglycans in cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05218  Melanoma
hai05224  Breast cancer
hai05410  Hypertrophic cardiomyopathy
hai05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109387785 (IGF1)
   04014 Ras signaling pathway
    109387785 (IGF1)
   04015 Rap1 signaling pathway
    109387785 (IGF1)
   04066 HIF-1 signaling pathway
    109387785 (IGF1)
   04068 FoxO signaling pathway
    109387785 (IGF1)
   04151 PI3K-Akt signaling pathway
    109387785 (IGF1)
   04152 AMPK signaling pathway
    109387785 (IGF1)
   04150 mTOR signaling pathway
    109387785 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109387785 (IGF1)
   04115 p53 signaling pathway
    109387785 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109387785 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    109387785 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    109387785 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    109387785 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    109387785 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109387785 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    109387785 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109387785 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    109387785 (IGF1)
   04213 Longevity regulating pathway - multiple species
    109387785 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109387785 (IGF1)
   05202 Transcriptional misregulation in cancer
    109387785 (IGF1)
   05205 Proteoglycans in cancer
    109387785 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    109387785 (IGF1)
   05218 Melanoma
    109387785 (IGF1)
   05215 Prostate cancer
    109387785 (IGF1)
   05224 Breast cancer
    109387785 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    109387785 (IGF1)
   05414 Dilated cardiomyopathy
    109387785 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109387785 (IGF1)
   01522 Endocrine resistance
    109387785 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hai04052]
    109387785 (IGF1)
Cytokines and growth factors [BR:hai04052]
 Growth factors
  Growth factors (RTK binding)
   109387785 (IGF1)
SSDB
Motif
Pfam: Insulin DUF2865
Other DBs
NCBI-GeneID: 109387785
NCBI-ProteinID: XP_019507444
LinkDB
Position
Un
AA seq 187 aa
MGKISSLPTQLFKCCFCDFLKVKMHIMSSSHLFYLALCLLTFTSSATAGPETLCGAELVD
ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKAARS
VRAQRHTDMPKAQKYQPPSTNKKTKSQRRRKGGPKKPPGGEQKEGTEASQQMKGKKKEQR
RETGARN
NT seq 564 nt   +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaacccaattatttaagtgctgcttttgtgatttcttg
aaggtaaagatgcacatcatgtcctcctcgcatctcttctacctggctctgtgcttgctc
accttcaccagctctgccacagctgggccggagacactgtgcggggctgagctggtggat
gctcttcagttcgtgtgtggagaccggggcttttatttcaacaagcccacgggttacggc
tccagcagtcggagggcgcctcagacaggcatcgtggacgagtgctgcttccggagctgt
gacctgaggaggctggagatgtactgcgcacccctcaagcctgccaaggcagcccgctct
gtccgtgcccagcgccacaccgacatgcccaaggctcagaagtatcagcccccatctacc
aacaagaaaacgaagtctcagaggagaaggaaaggtgggccaaagaaacccccaggaggg
gaacagaaggaggggacggaagcaagtcagcagatgaaaggaaagaagaaagagcagagg
agggagactggagctagaaactga

DBGET integrated database retrieval system