KEGG   Hipposideros armiger (great roundleaf bat): 109387871
Entry
109387871         CDS       T04661                                 

Gene name
IL6
Definition
(RefSeq) interleukin 6
  KO
K05405  interleukin 6
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01523  Antifolate resistance
hai04060  Cytokine-cytokine receptor interaction
hai04061  Viral protein interaction with cytokine and cytokine receptor
hai04066  HIF-1 signaling pathway
hai04068  FoxO signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04218  Cellular senescence
hai04620  Toll-like receptor signaling pathway
hai04621  NOD-like receptor signaling pathway
hai04623  Cytosolic DNA-sensing pathway
hai04625  C-type lectin receptor signaling pathway
hai04630  JAK-STAT signaling pathway
hai04640  Hematopoietic cell lineage
hai04657  IL-17 signaling pathway
hai04659  Th17 cell differentiation
hai04668  TNF signaling pathway
hai04672  Intestinal immune network for IgA production
hai04931  Insulin resistance
hai04932  Non-alcoholic fatty liver disease
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai05010  Alzheimer disease
hai05020  Prion disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05132  Salmonella infection
hai05133  Pertussis
hai05134  Legionellosis
hai05135  Yersinia infection
hai05142  Chagas disease
hai05143  African trypanosomiasis
hai05144  Malaria
hai05146  Amoebiasis
hai05152  Tuberculosis
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05200  Pathways in cancer
hai05202  Transcriptional misregulation in cancer
hai05321  Inflammatory bowel disease
hai05323  Rheumatoid arthritis
hai05332  Graft-versus-host disease
hai05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109387871 (IL6)
   04668 TNF signaling pathway
    109387871 (IL6)
   04066 HIF-1 signaling pathway
    109387871 (IL6)
   04068 FoxO signaling pathway
    109387871 (IL6)
   04151 PI3K-Akt signaling pathway
    109387871 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109387871 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109387871 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    109387871 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109387871 (IL6)
   04620 Toll-like receptor signaling pathway
    109387871 (IL6)
   04621 NOD-like receptor signaling pathway
    109387871 (IL6)
   04623 Cytosolic DNA-sensing pathway
    109387871 (IL6)
   04625 C-type lectin receptor signaling pathway
    109387871 (IL6)
   04659 Th17 cell differentiation
    109387871 (IL6)
   04657 IL-17 signaling pathway
    109387871 (IL6)
   04672 Intestinal immune network for IgA production
    109387871 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109387871 (IL6)
   05202 Transcriptional misregulation in cancer
    109387871 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    109387871 (IL6)
   05321 Inflammatory bowel disease
    109387871 (IL6)
   05332 Graft-versus-host disease
    109387871 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109387871 (IL6)
   05020 Prion disease
    109387871 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    109387871 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    109387871 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109387871 (IL6)
   04931 Insulin resistance
    109387871 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109387871 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109387871 (IL6)
   05135 Yersinia infection
    109387871 (IL6)
   05133 Pertussis
    109387871 (IL6)
   05134 Legionellosis
    109387871 (IL6)
   05152 Tuberculosis
    109387871 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109387871 (IL6)
   05162 Measles
    109387871 (IL6)
   05164 Influenza A
    109387871 (IL6)
   05161 Hepatitis B
    109387871 (IL6)
   05168 Herpes simplex virus 1 infection
    109387871 (IL6)
   05163 Human cytomegalovirus infection
    109387871 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109387871 (IL6)
   05169 Epstein-Barr virus infection
    109387871 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109387871 (IL6)
   05144 Malaria
    109387871 (IL6)
   05142 Chagas disease
    109387871 (IL6)
   05143 African trypanosomiasis
    109387871 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109387871 (IL6)
   01523 Antifolate resistance
    109387871 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hai04052]
    109387871 (IL6)
Cytokines and growth factors [BR:hai04052]
 Cytokines
  Interleukins
   109387871 (IL6)
SSDB
Motif
Pfam: IL6 GCSF IL23 DUF4924 DUSP
Other DBs
NCBI-GeneID: 109387871
NCBI-ProteinID: XP_019507568
LinkDB
Position
Un
AA seq 209 aa
MNSLSTSSFSPVAFSLGLLLVMATAFPAPVPRGEDSKDDTTSKRPPLASTNQTESLIKSI
LSEISEVKNKICGNDDMCENRPTLLQENKLNLPKMLEKDGCFHSGFNQETCLMRITTGLL
EFQIYLEYLQSKFEENAKAMQMRTKALVLILKQKVKNPDEVTTPNPITNSSLLAEMQSQS
GWLENTTIHLILRSLEDFLEFSQRAVRIM
NT seq 630 nt   +upstreamnt  +downstreamnt
atgaactctctctccacaagctccttcagtccagtggccttctccctggggctactcctg
gtgatggctacagctttccctgccccagttccccgaggagaagattccaaagatgatacc
acctcaaagagaccaccactcgcctctacaaaccaaaccgaaagcctcattaagtccatc
ctctctgaaatctctgaagtaaaaaataagatatgtggcaatgatgacatgtgtgaaaac
aggccaacgttactgcaagaaaacaaactgaaccttccaaaaatgttagaaaaagatgga
tgcttccactctgggttcaatcaggaaacttgcttgatgagaatcaccaccggtcttttg
gagtttcagatctacctggagtacctacagagcaagtttgaggagaacgccaaggcaatg
cagatgagaaccaaagccctggtcctgatcctgaagcaaaaggtaaagaatccagatgaa
gtaaccacccccaacccaatcacaaactccagcctgctggctgagatgcagtcgcagagt
gggtggctggaaaacacgacaattcacctcatcctgagaagccttgaggatttcctggag
ttctcccagagggctgttcgcataatgtag

DBGET integrated database retrieval system