KEGG   Hipposideros armiger (great roundleaf bat): 109388365
Entry
109388365         CDS       T04661                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai04010  MAPK signaling pathway
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04020  Calcium signaling pathway
hai04066  HIF-1 signaling pathway
hai04068  FoxO signaling pathway
hai04072  Phospholipase D signaling pathway
hai04144  Endocytosis
hai04151  PI3K-Akt signaling pathway
hai04510  Focal adhesion
hai04520  Adherens junction
hai04540  Gap junction
hai04630  JAK-STAT signaling pathway
hai04810  Regulation of actin cytoskeleton
hai04912  GnRH signaling pathway
hai04915  Estrogen signaling pathway
hai04921  Oxytocin signaling pathway
hai04926  Relaxin signaling pathway
hai04928  Parathyroid hormone synthesis, secretion and action
hai04934  Cushing syndrome
hai05160  Hepatitis C
hai05163  Human cytomegalovirus infection
hai05165  Human papillomavirus infection
hai05171  Coronavirus disease - COVID-19
hai05200  Pathways in cancer
hai05205  Proteoglycans in cancer
hai05206  MicroRNAs in cancer
hai05210  Colorectal cancer
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05218  Melanoma
hai05219  Bladder cancer
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
hai05230  Central carbon metabolism in cancer
hai05231  Choline metabolism in cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109388365 (EGFR)
   04012 ErbB signaling pathway
    109388365 (EGFR)
   04014 Ras signaling pathway
    109388365 (EGFR)
   04015 Rap1 signaling pathway
    109388365 (EGFR)
   04630 JAK-STAT signaling pathway
    109388365 (EGFR)
   04066 HIF-1 signaling pathway
    109388365 (EGFR)
   04068 FoxO signaling pathway
    109388365 (EGFR)
   04020 Calcium signaling pathway
    109388365 (EGFR)
   04072 Phospholipase D signaling pathway
    109388365 (EGFR)
   04151 PI3K-Akt signaling pathway
    109388365 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109388365 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109388365 (EGFR)
   04520 Adherens junction
    109388365 (EGFR)
   04540 Gap junction
    109388365 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109388365 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    109388365 (EGFR)
   04915 Estrogen signaling pathway
    109388365 (EGFR)
   04921 Oxytocin signaling pathway
    109388365 (EGFR)
   04926 Relaxin signaling pathway
    109388365 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    109388365 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109388365 (EGFR)
   05206 MicroRNAs in cancer
    109388365 (EGFR)
   05205 Proteoglycans in cancer
    109388365 (EGFR)
   05230 Central carbon metabolism in cancer
    109388365 (EGFR)
   05231 Choline metabolism in cancer
    109388365 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109388365 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109388365 (EGFR)
   05212 Pancreatic cancer
    109388365 (EGFR)
   05225 Hepatocellular carcinoma
    109388365 (EGFR)
   05226 Gastric cancer
    109388365 (EGFR)
   05214 Glioma
    109388365 (EGFR)
   05218 Melanoma
    109388365 (EGFR)
   05219 Bladder cancer
    109388365 (EGFR)
   05215 Prostate cancer
    109388365 (EGFR)
   05213 Endometrial cancer
    109388365 (EGFR)
   05224 Breast cancer
    109388365 (EGFR)
   05223 Non-small cell lung cancer
    109388365 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109388365 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    109388365 (EGFR)
   05171 Coronavirus disease - COVID-19
    109388365 (EGFR)
   05163 Human cytomegalovirus infection
    109388365 (EGFR)
   05165 Human papillomavirus infection
    109388365 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109388365 (EGFR)
   01522 Endocrine resistance
    109388365 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109388365 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109388365 (EGFR)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109388365 (EGFR)
Protein kinases [BR:hai01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   109388365 (EGFR)
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   109388365 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   109388365 (EGFR)
  Exosomal proteins of bladder cancer cells
   109388365 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like Kdo
Other DBs
NCBI-GeneID: 109388365
NCBI-ProteinID: XP_019508571
LinkDB
Position
Un
AA seq 1207 aa
MRPSGPLAAALLVLLAAHLPGSRAREEKRVCQGTNNKLTQLGTYEDHFLSLQRMLNNCEV
VLGNLEITYMQRNYDLSFLKTIQEVAGYVLIALNVVEKIPLENLQIIRGNVLFENTHALS
VLSNYGANKTGLRELPMRNLQEILQGAVRFNNNPALCNVDTIQWSDIVGSSFMSNMSTDF
QNQLDSCQKCDPSCPNGSCWGAGKENCQKLTKLICAQQCSGRCRGRSPSDCCHNQCAAGC
TGPRESDCLVCRRFRDEATCKDTCPPLMLYNPTTYQMDINSEGKYSFGATCVKKCPRNYV
VTDHGSCVRACSSDSYEVEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINATNIKHFK
NCTAISGDLHILPVAFKGDSFTHTPPLDPKELDILKTVKEITGFLLIQAWPENRTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLDITSLGLRSLKEISDGDVIISGNRKLCYTNTINWKQL
FGTSSQKTKIVGNRAKNDCEAIGHVCHPLCSSEGCWGPEPKDCVSCRNVSRDRECVEKCN
VLEGEPREFVENSECIQCHPECLPQAMNVTCTGHGPDNCVECAHYIDGPHCVKTCPAGIM
GENNTLVWKFSDANHVCHLCHPNCTYGCSGPGLEGCPVIPPKIPSIATGIVGGLLLVVVV
ALGVGLFLRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKIKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELRESTSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISTILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELIVEFSKMARDPQRYLVIQGDERMNLPSPTDSNFYRALMDEEDMEDVVDADEYLIPQ
QGFFHSPSTSRTPLLSSLSATSNTPTVACIDRNGQSCPLKEDSFLQRYSSDPTGTLTEDN
INDTFFPAPEYINQSVPKRPAGSVQNPVYHNQPLNPAPGRDPHYQNPHSNAVGNPEYLNT
THPARVSSGLDGPGPWVQNHQISLDNPDYQQDFLPKEARSNGIFKGPAAENAEYLRVAPP
SSEFIGA
NT seq 3624 nt   +upstreamnt  +downstreamnt
atgcgaccctcggggccgctggcggccgcgctcctggtgctgctggccgcgcacctcccc
gggagccgggcgcgggaggagaagcgagtttgccaaggcacaaataacaagctcacgcag
ctgggcacttatgaagaccactttctgagcctccaaaggatgctgaataactgtgaggtg
gtccttgggaacctggaaattacctacatgcaaaggaattatgacctttccttcttaaag
accatccaggaggttgctggctatgtcctcattgccctcaacgtagtggagaagattcct
ttggaaaacctgcagatcatccgaggaaatgtactcttcgaaaacacccatgccttatca
gtcttatccaactacggtgcaaacaaaacgggactgagggagctgcccatgagaaactta
caggaaatcctgcaaggcgccgtgcgattcaacaacaaccctgcactctgcaacgtggac
accatccagtggtcggacatcgtcggcagcagctttatgagcaatatgtcgacggacttt
cagaaccagctggacagctgccaaaagtgtgatccgagctgtcccaatggcagctgctgg
ggcgctgggaaggaaaactgtcagaaactgaccaaactcatctgtgcccagcagtgttca
ggacgctgtcgcggcaggtcccccagcgattgctgccacaaccagtgtgcggctggctgc
accgggccccgggagagcgactgcctggtgtgccgcaggttccgggatgaagccacatgc
aaagacacctgcccgccgctcatgctctacaaccccaccacctaccagatggacatcaac
tcagagggaaaatacagctttggcgccacctgtgtgaagaaatgcccacggaactatgtg
gtgacagatcatggctcgtgtgtccgtgcctgcagttctgacagctacgaggtggaagaa
gatggggtccgcaaatgtaaaaagtgcgaagggccctgtcgcaaagtttgtaatggaata
ggaattggtgaatttaaggacacactttccataaatgctacaaacatcaagcacttcaaa
aattgcaccgccatcagcggggatcttcacatcctccctgtagcatttaagggtgactcc
ttcacacatactccacccctagatccgaaggagctggatatcctcaaaactgtgaaggaa
ataacagggtttctgctgattcaggcctggccagaaaacagaactgaccttcacgctttt
gagaacctggagattatccgaggcagaacaaagcaacacgggcagttttctcttgcggtt
gttggcctagacataacgtccctgggattacgctccctcaaggagataagcgatggagat
gtgatcatctcaggaaaccgaaaattgtgctacacaaacacgataaactggaaacaacta
tttgggacctcaagtcagaaaaccaagattgtaggcaacagggctaaaaacgactgcgag
gccataggccatgtttgtcacccgctatgctcgtcagagggctgctggggcccagagcca
aaggactgcgtatcctgccgaaatgtcagccgtgacagggaatgcgtggagaaatgcaac
gttctagagggcgagcccagggagtttgtggagaattccgagtgcattcagtgccatcca
gagtgcctgcctcaggccatgaacgtgacctgcacgggacacggaccggacaactgtgta
gagtgcgcccactacatcgatggaccccactgtgtgaagacctgcccagcggggatcatg
ggagaaaacaacacgctggtctggaagttttcagatgccaatcacgtgtgtcacctgtgc
catccaaactgcacctatggctgctctgggccaggccttgaaggctgccccgtgattccg
cccaagatcccatccatcgccactgggattgtgggcggcctcttactggtggtggtggtg
gcactcggggttggcctctttctgcgcaggcgccacatcgtccggaaacgcacgctgcgc
cgactgctgcaggaaagagagctggttgagcccctcacacccagcggagaagctcccaac
caagctctcctgaggatcctaaaggaaacggaattcaaaaagatcaaggtgctaggctct
ggagcgttcggcacagtgtacaagggactctggatcccagagggtgagaaggttaaaatc
cctgtggccatcaaggagttaagagaatccacgtctccgaaagccaacaaggagattctc
gatgaagcctacgtgatggccagcgtggacaaccctcacgtgtgccgcctgctgggcatc
tgcctcacttccacggtccagctcatcacacagctcatgcccttcggctgcctcctggac
tatgtccgcgagcacaaggacaacatcggctcccagtacctgctcaactggtgtgtgcag
atcgccaagggcatgaactacctggaggaccggcgcctggtgcaccgtgacctggccgcc
aggaatgtcctggtgaagacgccacagcacgtcaagatcacagacttcgggctggccaag
ctgctgggggccgaggagaaggagtaccacgcggaaggaggcaaagtgcctatcaagtgg
atggctttggaatccattttacaccgaatttacacccaccaaagtgacgtctggagctat
ggggtcaccgtttgggagctgatgacctttgggtccaagccttacgacggaatcccggca
agtgagatctcaaccattctggagaaaggcgagcgcctcccgcagccgcccatatgcacc
atcgacgtctacatgatcatggtcaaatgctggatgatagatgcagatagtcgcccaaaa
ttccgcgagttaatcgttgaattctccaaaatggcccgagacccccagcgttaccttgtc
atccagggggatgagagaatgaacctgcccagcccgacagactccaatttctatcgcgcc
ctgatggacgaagaggacatggaggacgtcgtggacgcggacgagtacctcattccgcag
caaggcttcttccacagcccctccacgtcccggaccccacttctgagttctctgagcgcc
accagcaacactcccactgtggcctgcattgacagaaacgggcagagctgtcccctcaag
gaagacagctttctgcagcgctacagctcagatcccacaggcaccctgactgaggacaac
ataaatgacactttcttcccggcgcctgaatacataaaccagtccgttcccaaaaggccc
gcgggctctgtccaaaacccggtctatcacaatcagcctctaaacccagctcctggcaga
gaccctcactaccaaaacccgcacagcaacgccgtgggcaaccctgagtatctcaatacc
acccatcctgcccgcgtcagtagtgggctcgacgggcctggcccctgggtgcagaaccac
caaatcagcctggacaaccctgactaccagcaggacttcctcccgaaggaagccaggtca
aatggcatctttaagggtcctgcagctgaaaatgcagagtacctaagggtagcaccaccg
agcagtgaatttattggagcatga

DBGET integrated database retrieval system