KEGG   Hipposideros armiger (great roundleaf bat): 109388568
Entry
109388568         CDS       T04661                                 

Gene name
TICAM1
Definition
(RefSeq) toll like receptor adaptor molecule 1
  KO
K05842  toll-like receptor adapter molecule 1
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04064  NF-kappa B signaling pathway
hai04217  Necroptosis
hai04620  Toll-like receptor signaling pathway
hai04621  NOD-like receptor signaling pathway
hai05133  Pertussis
hai05135  Yersinia infection
hai05142  Chagas disease
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    109388568 (TICAM1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109388568 (TICAM1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109388568 (TICAM1)
   04621 NOD-like receptor signaling pathway
    109388568 (TICAM1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109388568 (TICAM1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109388568 (TICAM1)
   05133 Pertussis
    109388568 (TICAM1)
  09172 Infectious disease: viral
   05164 Influenza A
    109388568 (TICAM1)
   05161 Hepatitis B
    109388568 (TICAM1)
   05160 Hepatitis C
    109388568 (TICAM1)
   05168 Herpes simplex virus 1 infection
    109388568 (TICAM1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109388568 (TICAM1)
   05165 Human papillomavirus infection
    109388568 (TICAM1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109388568 (TICAM1)
SSDB
Motif
Pfam: TRIF-NTD RHIM TIR_2 CG-1
Other DBs
NCBI-GeneID: 109388568
NCBI-ProteinID: XP_019508889
LinkDB
Position
Un
AA seq 693 aa
MPMACPGPSLSSAFDILHAAGHDKLLYLKHKLKTLHPGCRGAHLLHTMVLLTLGQETEAR
ISLEALKVDAVARLVARQWAGMDSSASAPEETPDVSWAIARVYHLLAEEKLCPAPVRDEA
YRAALQASSLREDPQLGELQEEARDRCGWDIVGDPGVFQPLHSDLDCLPLSSGTRSLPQP
IENPLGWSRGCSLRSTGSPASLASNLEISHSPTMALLSSHRSPHGPSKLCDEPPVSPVPE
PVPMGCQEPEEMSWPPSGAIADTPVPPNSPGPRLPEVALDASPAGLPDSSEAPDISTHYP
VECTEVSPAPKSLPSPSRNPCPVKDQMPLQPPIEDTTSSTAQPSPPTPSAPKTSSPNPSP
STPLAHPASSSPCPPSPELESSEQKFYNFVVLHSREDEHIALRVREKLESLGVPNGATFC
EDFQVPGRGELCCLQDAIDHSAFTILLLTANFDRRLCLHQVNQSLMNSLTQPGRQDCVIP
FLPLESSQAQVSPYTSSLLRSLVWLDEHSLIFARKVANTFKPQKLRACKTNWKKDQDTRA
LREQHQRLEGERQQAAAWNAAYSAYLQSYLSWHEQMENLQAAFRSHTTLGTQVPYGGQGP
LGTQLPFSTWPGHQPPSLPPWLAGSHPPAFPQPPAFPQPPAFPTTPQSTATPQSPGLQPL
IIHHAQMVQLGLNNHMWNQKGTQEPEDKTQEAE
NT seq 2082 nt   +upstreamnt  +downstreamnt
atgcccatggcctgcccgggcccgtctctctccagcgcctttgacattctacatgcggca
ggccacgacaagctcctgtatcttaagcacaagttgaagaccctgcacccgggctgccgg
ggggcacacctcctacacacgatggtgctcctgacgctgggccaggagaccgaggccagg
atctctctggaggccctgaaggtggatgcggtggccaggcttgtggcccgccagtgggcc
ggcatggacagcagtgccagtgccccggaggagaccccagatgtgtcctgggccattgcc
cgggtgtaccacctgcttgccgaggagaagctgtgcccggccccagtgcgggacgaggct
taccgggcagccctccaggcttctagcttgagggaggacccccagcttggggagctccaa
gaggaggcccgggaccggtgtgggtgggacatcgttggggacccaggggtcttccagccc
ctccactctgatctggactgcctcccgctgtcctctgggacccgcagtcttcctcagccc
attgagaatcccttgggctggagcagagggtgctccctgagatccactggcagcccagcc
tccctggccagcaacttggaaattagccattcgcccaccatggccctcctcagctcgcac
cgtagcccccatgggcccagcaagctgtgtgatgagcctccggtcagcccagtgcccgag
cctgtccccatgggctgccaggagcctgaggagatgagctggcctccatcgggggcgatt
gctgacaccccagtgccaccaaacagcccaggccccaggcttcctgaggtggccctagat
gcaagccctgctggcctgcctgactcctccgaagctccagacatcagcacccactaccca
gtggaatgcacagaagtgtcaccagcccccaaatctctaccctcaccctccagaaatccc
tgccctgtcaaggaccagatgccactacaacctcccatagaagacaccacttcctcaaca
gcccagccaagcccaccgactccctcagccccgaagacatcctctcccaatccctctcca
tctacccctttggctcacccagcttcatcgagcccatgtcccccttctcctgagttagag
tcatcggagcagaaattctataactttgtggtcttgcactccagggaggatgagcacatt
gccctgcgtgtccgggagaagctcgaatctctgggtgtgcccaatggggccaccttctgc
gaggatttccaggtgcccgggcgtggtgagctgtgctgcctgcaagacgccatagaccac
tcggccttcaccatcctgctgctcactgccaactttgaccgtcgcctgtgcctgcaccaa
gtgaaccagtcgctgatgaacagcctcacgcagcccgggcggcaagactgcgtgatccct
ttcctgcccctggagagttcccaggcccaggttagcccctacacgtccagcctgctcaga
agcctggtgtggctggacgagcactccctaatcttcgccaggaaggtggccaacaccttc
aagccccagaagctgcgggcctgcaagaccaactggaagaaggatcaggatactcgggcc
ctgcgggagcagcaccagcgcctggagggtgagcggcagcaggcagccgcgtggaatgcc
gcgtactcagcctaccttcagagctacttgtcctggcatgagcagatggagaacctccag
gcagctttcaggagccacacgacacttgggactcaggtgccttatgggggccaagggccc
ctgggaacccagctacccttttctacctggcctggccatcagccaccgtccctacctcca
tggctggctggcagccacccaccggccttcccacaaccaccggccttcccgcagccacca
gccttccctacgacccctcagagcactgcgacccctcagagccctggactgcagcccctc
attatccaccatgcacaaatggtgcagctggggctcaacaaccatatgtggaaccagaaa
gggacccaggagcctgaggacaagacacaggaagcagaatga

DBGET integrated database retrieval system