KEGG   Hipposideros armiger (great roundleaf bat): 109388707
Entry
109388707         CDS       T04661                                 

Gene name
IL18
Definition
(RefSeq) interleukin 18
  KO
K05482  interleukin 18
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04060  Cytokine-cytokine receptor interaction
hai04061  Viral protein interaction with cytokine and cytokine receptor
hai04621  NOD-like receptor signaling pathway
hai04623  Cytosolic DNA-sensing pathway
hai05132  Salmonella infection
hai05134  Legionellosis
hai05135  Yersinia infection
hai05143  African trypanosomiasis
hai05144  Malaria
hai05152  Tuberculosis
hai05164  Influenza A
hai05321  Inflammatory bowel disease
hai05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109388707 (IL18)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109388707 (IL18)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109388707 (IL18)
   04623 Cytosolic DNA-sensing pathway
    109388707 (IL18)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    109388707 (IL18)
   05321 Inflammatory bowel disease
    109388707 (IL18)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109388707 (IL18)
   05135 Yersinia infection
    109388707 (IL18)
   05134 Legionellosis
    109388707 (IL18)
   05152 Tuberculosis
    109388707 (IL18)
  09172 Infectious disease: viral
   05164 Influenza A
    109388707 (IL18)
  09174 Infectious disease: parasitic
   05144 Malaria
    109388707 (IL18)
   05143 African trypanosomiasis
    109388707 (IL18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hai04052]
    109388707 (IL18)
Cytokines and growth factors [BR:hai04052]
 Cytokines
  Interleukins
   109388707 (IL18)
SSDB
Motif
Pfam: IL1
Other DBs
NCBI-GeneID: 109388707
NCBI-ProteinID: XP_019509204
LinkDB
Position
Un
AA seq 186 aa
MAAEPEDNYISFVEMKFIDNTLYFVENLESDYFGKLEPRFSIIRNLNNQVLFIRAGHALL
EDMTDADCEANASQTTFIIYMYKDNLARGLAVALSVKYGKIATLSCKDKAISFKEMNPPD
YISEEESEIIFFKRSVPGHDKILFESSLYKGYFLACKKENNLFKLILKEKDKQGDESIMF
TVQYKD
NT seq 561 nt   +upstreamnt  +downstreamnt
atggctgctgaaccagaagacaattacatcagctttgtggaaatgaaatttattgacaat
acactttactttgtagaaaacctggaatcagattactttggcaagctcgaacctagattc
tcaatcatacgaaatttgaacaaccaagttctcttcattcgtgcgggacacgctctgtta
gaagatatgactgatgctgactgtgaagcaaatgcatcccagactacattcatcatatat
atgtataaagataacctcgctagaggtctggccgtagccctctctgtgaagtatggtaaa
attgctactctctcctgtaaggacaaagctatttcctttaaggaaatgaatcctcctgat
tatatcagtgaagaagaaagtgaaatcatattctttaagagaagtgttccaggacatgac
aagatactattcgagtcttcactgtacaaaggatactttctagcttgtaaaaaagagaat
aaccttttcaaactcattttgaaagaaaaggacaaacagggcgatgaatctataatgttc
actgttcaatacaaggactag

DBGET integrated database retrieval system