KEGG   Hipposideros armiger (great roundleaf bat): 109388950
Entry
109388950         CDS       T04661                                 

Gene name
CACNA1C
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04010  MAPK signaling pathway
hai04020  Calcium signaling pathway
hai04022  cGMP-PKG signaling pathway
hai04024  cAMP signaling pathway
hai04260  Cardiac muscle contraction
hai04261  Adrenergic signaling in cardiomyocytes
hai04270  Vascular smooth muscle contraction
hai04713  Circadian entrainment
hai04720  Long-term potentiation
hai04723  Retrograde endocannabinoid signaling
hai04724  Glutamatergic synapse
hai04725  Cholinergic synapse
hai04726  Serotonergic synapse
hai04727  GABAergic synapse
hai04728  Dopaminergic synapse
hai04742  Taste transduction
hai04911  Insulin secretion
hai04912  GnRH signaling pathway
hai04921  Oxytocin signaling pathway
hai04924  Renin secretion
hai04925  Aldosterone synthesis and secretion
hai04927  Cortisol synthesis and secretion
hai04929  GnRH secretion
hai04930  Type II diabetes mellitus
hai04934  Cushing syndrome
hai04935  Growth hormone synthesis, secretion and action
hai05010  Alzheimer disease
hai05020  Prion disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05031  Amphetamine addiction
hai05410  Hypertrophic cardiomyopathy
hai05412  Arrhythmogenic right ventricular cardiomyopathy
hai05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109388950 (CACNA1C)
   04020 Calcium signaling pathway
    109388950 (CACNA1C)
   04024 cAMP signaling pathway
    109388950 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    109388950 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    109388950 (CACNA1C)
   04929 GnRH secretion
    109388950 (CACNA1C)
   04912 GnRH signaling pathway
    109388950 (CACNA1C)
   04921 Oxytocin signaling pathway
    109388950 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    109388950 (CACNA1C)
   04924 Renin secretion
    109388950 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    109388950 (CACNA1C)
   04927 Cortisol synthesis and secretion
    109388950 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    109388950 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    109388950 (CACNA1C)
   04270 Vascular smooth muscle contraction
    109388950 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    109388950 (CACNA1C)
   04727 GABAergic synapse
    109388950 (CACNA1C)
   04725 Cholinergic synapse
    109388950 (CACNA1C)
   04728 Dopaminergic synapse
    109388950 (CACNA1C)
   04726 Serotonergic synapse
    109388950 (CACNA1C)
   04720 Long-term potentiation
    109388950 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    109388950 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    109388950 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109388950 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109388950 (CACNA1C)
   05020 Prion disease
    109388950 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    109388950 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    109388950 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    109388950 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109388950 (CACNA1C)
   05414 Dilated cardiomyopathy
    109388950 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109388950 (CACNA1C)
   04934 Cushing syndrome
    109388950 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hai04040]
    109388950 (CACNA1C)
Ion channels [BR:hai04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   109388950 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel
Other DBs
NCBI-GeneID: 109388950
NCBI-ProteinID: XP_019509594
LinkDB
Position
Un
AA seq 2225 aa
MLRALVQPATPAYQPLPSHPSETEGKFKGTLVHEAQLNYFYTPPGGSSYGSPRPAHANMN
ANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNTTISTVSSTQRKRQQYGKPKK
QGSTTSTRPPRALLCLTLKNPIRRACINIVEWKPFEIIILLTIFANCVALAIYIPFPEDD
SNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAI
LEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHI
ALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTV
CKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIF
GSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPEN
EDEGMDEEKPRNRGAPAGLLDQKKGKFAWFSHSTETHVSMPTSETESVNTENVAGGDIEG
ENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHY
NQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILV
ETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFS
LLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPG
MLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARPARTAS
PEKKPEVLEKAAVEETKEEKIELKSITADGESPPATKINMDDLQPNENEDKSAYPNPETT
GDEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPNNRFRLQCHRIVNDTIFT
NLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTTEIALKMTAYGAFLHKGS
FCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVF
VAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGEVDH
PIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEIS
IFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYI
PKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTGLFT
VEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNHYFCDAWNTFDALIVVGSI
VDIAITEVNPAEHTQCSPFMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIK
SFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATG
EAWQDIMLACMPGKKCAPESEPGNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVI
MDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCP
HRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKR
TSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGL
RTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYYQSDGR
SAFPQTFTTQRPLHINKAGNSQGDTESPSHEKLVDSTFTPSSYSSTGSNANINNANNTAL
GRFPCPTGYPSAVSTVEGHGPPLSPAIRVQEAAWKLSSKRCHSRESQIAMVCQEEVSQGE
TYDVKMSEDSEYCSEPSLLPTEILPYQDDENRQLTPPEEDKRDIRQSPKRGFLRSASLGR
RASLHLECLKRQKNQGGDISQKTVLPLHLVHHQALAVAGLSPLLQRSHSPTTFPRLCATP
SATPGSRGWPPKPIPTLRLEGTESSEKLNSSFPSIHCSSWSGDPTPCGGGSSATRRARPV
SLTVPSQAGAWGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMTIEEM
ENAADNILSGGTQQSPNGTLLPFVNCRDPGQDRAGREEDEPCGPAQECRRSEEELQDHRA
YVSSP
NT seq 6678 nt   +upstreamnt  +downstreamnt
atgcttcgcgcccttgttcagcccgcaacgccggcataccagccacttcccagtcacccg
tctgaaaccgagggcaagtttaagggcacgttggtgcatgaagctcaactcaactatttc
tacacccctcctggaggttccagctatgggagtccacgcccagctcacgccaacatgaat
gccaatgcggcagcagggcttgcccctgagcacatccccaccccgggggcggccttgtcc
tggcaggcagccatcgatgcggcccggcaggccaagctgatgggaagcgctggcaacacg
accatctccacagtcagctccacacagcggaagcggcagcagtatgggaaacccaagaag
cagggcagcacgacgtccacgcgcccgcctcgcgccctgctctgcctgactctaaagaac
cccattcggagggcgtgcataaacatcgtggaatggaaaccatttgaaatcattatttta
ctgaccatttttgccaattgtgtggccttagcgatctatattccctttccagaagatgac
tccaacgccaccaattccaacttggaacgagtggaatatctctttctcatcatttttact
gtggaagcatttttaaaagtcatagcctatggacttctctttcaccccaatgcttacctc
cgcaacggttggaatttactcgatttcataattgtggtcgtagggctttttagtgcaatt
ttagaacaagcaaccaaagctgacggggccaatgccctaggagggaagggggctggattt
gacgtgaaggctttgagggcgttccgtgtgctgcgccccctgcggctggtgtccggagtc
ccgagtctccaggtggttctgaattccatcattaaggccatggtccccctgctgcatatc
gcccttctcgtgctatttgtcatcatcatctacgctatcatcggcctggagctcttcatg
gggaaaatgcacaagacctgctacaaccaggagggcatagcagatgttccagcagaagat
gatccttccccttgtgccctggagacaggccacgggcgacagtgccaaaacggcacagtg
tgcaagcccggctgggatgggcccaagcacggcatcaccaactttgacaattttgccttc
gccatgttgacagtgttccaatgcatcaccatggagggctggacagacgtgttgtactgg
atgcaggacgctatgggctatgagttaccatgggtgtattttgtcagtctggtcatcttt
ggatcctttttcgttctaaatctggttctcggtgtgttgagcggagagttttccaaagag
agggagaaggccaaagctcggggagatttccaaaagctgcgagagaagcagcagctggaa
gaggacctgaaaggctacctggactggattactcaggcagaagacatcgaccctgagaac
gaggacgaaggcatggatgaggagaaaccccgaaacagaggcgctccagcgggcttgctt
gatcagaagaaagggaagtttgcttggtttagtcactccacagaaacccatgtgagcatg
cccacaagtgagacggagtctgtcaacactgagaacgtggctggaggagacatcgaggga
gaaaactgtggggccaggctggcccaccggatctccaagtcgaagttcagccgctactgg
cgccggtggaatcggttctgcaggaggaagtgtcgcgccgcagtcaagtccaatgtcttc
tactggctggtgattttcctggtgttcctcaacacgctcaccattgcctcagagcactac
aaccagccccactggctcacagaagtccaagacacggccaacaaggcactactggcgctc
ttcactgcggagatgctgttgaagatgtacagcctgggcctgcaggcctacttcgtgtcc
ctcttcaaccgcttcgattgcttcatcgtgtgtgggggcatcctggagaccatcctggtg
gagaccaagatcatgtcgcccttgggtatctctgtgctgagatgtgtccggctactgagg
atatttaaaatcacaaggtactggaactcgctgagcaacctggtggcatccttgctgaac
tctgtgcgatccatcgcctccctactgctactcctctttctcttcatcatcatcttctcc
ctcctggggatgcagctgtttggagggaagttcaactttgacgagatgcagacccggagg
agcacgtttgataactttccccaatccctcctcaccgtgtttcagatcctgaccggggag
gactggaattcggtgatgtatgatgggatcatggcttatggcggcccctcttttccaggg
atgttagtctgtatttacttcatcatcctcttcatctgtggaaactatatcctactgaac
gtgtttttggccattgccgtggataacctggccgatgccgagagcctcacatctgcccaa
aaggaggaagaggaagagaaggagagaaagaagctagccagaccggccaggactgccagc
ccagagaaaaaaccagaggtgttggagaaggcggccgtagaggagaccaaggaggagaaa
atcgagctgaaatccattacagctgatggagagtccccgcccgccaccaagatcaacatg
gatgatcttcagcccaatgaaaatgaggataagagcgcctaccccaacccagaaacaaca
ggagacgaagatgaggaggagcctgagatgcccgtgggccctcgcccacgaccgctgtct
gagctgcaccttaaggaaaaggcagtgcccatgccagaagccagtgcatttttcatcttc
agccccaacaacaggtttcgcctccagtgccaccgcattgtcaatgacaccatcttcacc
aacctgatcctcttcttcattctgctcagcagcatttccctggctgctgaggaccccgtc
cagcacacgtccttcaggaaccatattctgttttattttgatattgtttttactaccatt
ttcaccaccgaaattgctctgaagatgactgcttatggggctttcttgcacaagggctcc
ttttgccggaactacttcaacattttggacctgctagtggtcagcgtgtccctcatctcc
ttcggcatccagtccagtgcaatcaacgtagtaaagatcttgcgagttctgcgagtactc
aggcctctgagggccatcaacagagccaagggactgaagcacgtggttcagtgtgtgttt
gtcgccatccggaccatcggcaacatcgtgattgtcaccacgctgcttcagttcatgttc
gcctgcatcggggtccagctcttcaagggaaagctctacacctgttcagatagttccaag
cagactgaggcagaatgcaagggtaactacatcacctacaaggacggggaggttgaccac
cccatcatccagccccgcagctgggagaacagcaagtttgactttgacaatgttctggcg
gccatgatggccctcttcactgtctccacctttgaggggtggccagagctgctgtaccgc
tccatcgactcccacacagaagacaagggccccatctacaactaccgcgtggagatctcc
atcttcttcatcatctacatcatcatcatcgccttcttcatgatgaacatctttgtgggt
ttcgtcatcgtcaccttccaggaacagggagagcaggagtacaagaactgtgagctggac
aagaaccagcgacaatgcgtggagtacgccctcaaggcccgacccctgaggaggtacatc
cccaagaaccagcaccaatacaaagtgtggtacgtggtcaactccacctactttgagtac
ctgatgtttgtcctcatcctgctcaacaccatctgcttggccatgcagcactatgggcag
agctgcctgttcaaaatcgccatgaacatcctcaacatgctcttcactggtcttttcact
gtggagatgattctgaagctcattgccttcaaacccaagggttactttagtgatccctgg
aatgtttttgacttcctcatcgtaattggcagcataattgacgtcattctcagtgaaact
aatcactatttctgtgatgcatggaatacatttgacgccttgattgttgtgggtagcatt
gttgatatagcaatcaccgaggtaaacccagctgaacatacccaatgctctccctttatg
aatgcagaggagaactcccgcatctccatcaccttcttccgcctcttccgggtcatgcgc
ctggtcaagctgctgagccgtggggagggcatccggaccctgctctggaccttcatcaag
tccttccaggccctgccctacgtggcccttctgatagtgatgctgttcttcatctatgca
gtgatcgggatgcaggtgtttggaaaaattgctctgaacgataccacagagataaaccgg
aacaacaactttcagaccttccctcaagctgtgctgctgctcttcaggtgtgccaccggg
gaggcgtggcaggacatcatgctggcctgcatgccggggaagaagtgcgccccagagtca
gagcccggcaacagcacggaaggggagacgccctgcggcagcagcttcgccgtcttctac
ttcatcagtttctacatgctctgtgccttcctgatcatcaacctctttgtggctgtcatc
atggacaactttgactaccttacaagggactggtcaatccttggtccccaccatctggac
gaatttaaaagaatctgggcagagtatgaccctgaagccaagggccgcatcaaacaccta
gatgtggtgactctgctccggcggattcagcccccactgggttttggaaagctgtgccct
caccgtgtggcttgcaaacgcctggtctccatgaacatgcctctgaacagtgatgggaca
gtcatgttcaatgccaccctgtttgccctggtccggacagccctgaggatcaaaacagaa
gggaacctggaacaagccaatgaggagttgcgggccataatcaagaagatctggaagagg
accagcatgaagctgctggaccaggtggtcccccccgcgggtgatgatgaggtcacggtt
ggcaagttttatgctactttcctgatccaagagtacttccggaaattcaagaagcgcaaa
gagcaggggctcgtgggcaagccctcccagaggaacgccttgtccctgcaggctggcttg
cgcacgctgcacgacatcgggcccgagatccgacgcgccatctctggagatctgacagct
gaggaggagttggacaaagccatgaaggaggctgtgtctgcggcttctgaagacgacatc
ttcaggagggctggtggcctgttcggcaaccatgtcagctactaccaaagcgacggccgg
agcgccttcccccagaccttcaccacccagcgcccactgcacatcaacaaagcgggcaac
agccaaggcgacaccgagtcgccatcccacgagaaactggtggactccaccttcaccccc
agcagctactcatccactggctccaacgccaacatcaacaatgccaacaacactgccctg
ggccgcttcccctgccccaccggctatcccagcgcagtcagcaccgtggagggccacggc
ccccccttgtctcctgccatccgggtgcaggaggcagcgtggaagctcagctccaagagg
tgccactcccgggagagccagatagccatggtgtgtcaagaggaggtctctcagggcgag
acctatgacgtgaagatgagtgaagatagcgagtactgcagcgagcccagcctgctcccc
acagagatactcccctatcaggatgatgaaaaccgacaattgacaccccctgaggaggac
aagagggacatccggcaatctccaaagaggggtttcctccgctctgcctccctaggtcga
agagcctccttgcacctggaatgtctgaagcgacagaagaatcaagggggagacatctct
cagaagacagtcctgcccttgcacctagttcatcatcaggcattggcagtggcaggcctg
agccccctcctccagagaagccattcccccacaacattccccaggctatgtgccaccccc
tctgccacgcccggcagccgaggctggcccccgaagcccatccccaccctgcggctggaa
ggaaccgagtccagcgagaaactcaacagcagcttcccatccatccactgcagctcctgg
tctggggatcccacaccctgtggggggggcagcagtgccacccggagagcccggcctgtg
tccctcactgtgcccagccaggccggggcctggggtcggcagttccacggcagtgccagc
agtctggtggaagcggtcttgatttcggaaggactggggcagtttgctcaagatcccaag
ttcatcgaggtcacaacccaggagctggctgatgcctgcgacatgaccatagaggagatg
gagaatgctgctgacaacattctcagtgggggcacccagcagagccccaatggcaccctc
ttaccttttgtgaactgcagggacccggggcaggacagagcagggcgcgaagaggatgag
ccctgtgggcccgcccaggagtgtcggagaagcgaagaggagctgcaggaccacagggcc
tatgtcagcagcccgtag

DBGET integrated database retrieval system