KEGG   Hipposideros armiger (great roundleaf bat): 109389034Help
Entry
109389034         CDS       T04661                                 

Gene name
MARVELD3
Definition
(RefSeq) MARVEL domain containing 3
  KO
K21099  MARVEL domain-containing protein 3
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04530  Tight junction
Brite
KEGG Orthology (KO) [BR:hai00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109389034 (MARVELD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hai02000]
    109389034 (MARVELD3)
Transporters [BR:hai02000]
 Other transporters
  Pores ion channels [TC:1]
   109389034 (MARVELD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_9_N MARVEL SIT
Motif
Other DBs
NCBI-GeneID: 109389034
NCBI-ProteinID: XP_019509803
LinkDB All DBs
Position
Un
AA seq 383 aa AA seqDB search
MELTSGTREPRVRPRERDPDRHPRPDRDRHPERQRDRAEDRRRERNGGERRDGDRDRGRD
RDPRQDRHRSGDHRPGEQRVWEKPRQSRTRDGPQRPTRDAVPPTWPAPWETPELPPHRKE
GFGHRGPESEPTSGRYLPSNPRSGREEEKYYQSEAEGLLECHKCRYLCTGRGVVQIVEVI
LNGMVLMCIVASYFVLAGFSASFTSGGGFGNNYYSPFEGTELEQVRQLDQQYTVLRAPLI
YGGVAVSLGLGVLTMGVLLQGAKSLSKLPRKWLLLEAAFSLLAAVGYCIGIGIYLHVALR
INATDTCKTRQRLYARKGLTWMNCQLAGTDGAAATFACLLVIMYGASVVLALRSYREQKH
YKDSQEQHRNYSEAPEYLWSGTL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggaacttacgtcggggactcgagagccccgggtccggccgagagagcgggacccagac
cggcacccccgcccggaccgagaccgccacccagagcgacagcgggaccgagccgaggac
cggcgccgggagagaaacgggggcgagcggagggacggggaccgggacagggggcgggac
cgagacccccgccaggacagacacaggtccggggaccatcgccctggtgaacaaagagtt
tgggaaaaaccccgccaaagccggacgcgggacggacctcagcggccgaccagggacgca
gtcccgcccacctggcccgcgccctgggaaaccccggagctgccgccccacaggaaggag
ggcttcgggcaccgaggaccggaaagtgaacccacttcagggagatatctgccctcaaac
cccaggtctggacgagaggaagagaaatactaccaatcagaggctgaaggactcctggaa
tgccacaaatgcagatacttgtgcactgggagaggtgtggttcagatagtggaggtgata
ctgaatgggatggttctcatgtgtatcgtggcttcctactttgtccttgctggattcagt
gccagctttaccagcggcggcggctttgggaacaactattactcaccatttgagggcact
gagctggagcaggttcggcagctggaccagcagtacactgtcctgcgggcacccctgata
tacggcggcgtggctgtttctctggggctgggcgtcctcaccatgggtgttttactccaa
ggagccaagagtctaagcaaactgccacggaagtggctcctgctggaggctgccttcagc
ctcctggcagcagtgggctactgcataggcattggcatttacctccatgtagccttgcgg
atcaatgccacggacacttgcaaaacaagacagaggctgtatgcccgcaaaggtctcacc
tggatgaactgccagctggcaggcacggatggagcagcagccacctttgcttgtctcctg
gtgatcatgtatggtgccagcgtggtgctggccctccggagctaccgggagcagaagcac
tacaaagacagccaagaacagcacagaaattacagtgaggcaccagaatatctatggtct
ggaacactctga

DBGET integrated database retrieval system