KEGG   Hipposideros armiger (great roundleaf bat): 109389177
Entry
109389177         CDS       T04661                                 

Gene name
PABPN1L
Definition
(RefSeq) poly(A) binding protein nuclear 1 like, cytoplasmic
  KO
K14396  polyadenylate-binding protein 2
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai03015  mRNA surveillance pathway
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    109389177 (PABPN1L)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    109389177 (PABPN1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hai03019]
    109389177 (PABPN1L)
Messenger RNA biogenesis [BR:hai03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     109389177 (PABPN1L)
SSDB
Motif
Pfam: RRM_1 Nup35_RRM_2
Other DBs
NCBI-GeneID: 109389177
NCBI-ProteinID: XP_019510032
LinkDB
Position
Un
AA seq 281 aa
MWPFLSPALFPPPTEAWLQRASSDPEAQGWGACSWTEKTLRGPGCGDRKEEEETREAEDK
EDDEEDAGFPLSLLESEALAEHPVPDQELEAIKLKLWVMEQVQEPEPPRTQGQAGKEESP
GAIVAQQLLSPNTDCPCPATPMEKVEMDHRSIYVGNVDYGGTAEELEAYFNHCGEVQRVT
ILCDKFSGHPKGYAYIEFATESSAQAAVELDKSIFRGRVIKVLPKRTNIPGISSTDRGGL
RGRPGARGAPFPHSSLQGKAHFKPRGRNRGRGRVSPWYSPY
NT seq 846 nt   +upstreamnt  +downstreamnt
atgtggcctttcctcagtcctgctctcttcccaccccccaccgaggcctggctccagagg
gcttcctcagaccccgaggcccagggctggggggcctgcagctggaccgagaagaccctt
cgggggccagggtgtggggacaggaaggaggaggaggagaccagggaagcagaggacaag
gaggacgatgaggaagatgcaggcttccctctgtctctactagagagtgaggccctggcc
gagcacccggtacctgaccaggagctggaggccatcaaactgaagctatgggtcatggag
caggtccaggagccagagccacccaggacgcagggccaggcaggaaaagaggagagccct
ggggccatagtggcccagcagctgctgagtccaaacacagactgcccctgccctgcgacg
cccatggagaaggtggaaatggaccacagatccatctatgtgggcaacgtggactacggg
ggcacagctgaggagctggaggcttacttcaaccattgtggggaggtccagcgtgtcacc
atcctgtgcgacaagttctccggacaccccaaaggctatgcctacatagagtttgccact
gagagctcagcccaggctgctgtggagctagacaagagcatcttccgaggccgggtcatc
aaggtgctgcccaaaaggaccaacataccagggatcagctccacggaccgagggggcctg
cggggacgcccaggcgccaggggggcacccttcccccacagcagtctccagggcaaggcc
cacttcaaaccacgagggcgcaacaggggacgtggaagagtctcaccatggtattcaccg
tactga

KEGG   Hipposideros armiger (great roundleaf bat): 109393643
Entry
109393643         CDS       T04661                                 

Gene name
PABPN1
Definition
(RefSeq) poly(A) binding protein nuclear 1
  KO
K14396  polyadenylate-binding protein 2
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai03015  mRNA surveillance pathway
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    109393643 (PABPN1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    109393643 (PABPN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hai03019]
    109393643 (PABPN1)
Messenger RNA biogenesis [BR:hai03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     109393643 (PABPN1)
SSDB
Motif
Pfam: RRM_1 Seryl_tRNA_N
Other DBs
NCBI-GeneID: 109393643
NCBI-ProteinID: XP_019518610
LinkDB
Position
Un
AA seq 306 aa
MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPGEL
LLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEEEPGLVESDPGDGAIEDPELE
AIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVD
YGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGR
QIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRIYRGRARAT
SWYSPY
NT seq 921 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggcagcggcagcgggggctgcgggcggtcggggctccggg
ccggggcggcggcgccatcttgtgcccggggccggtggggaggccggggagggggccccg
gggggcgcaggggactacgggaacggcctggagtctgaggaactggagcctggggagttg
ctgctggagccggagcccgagcctgagcccgaagaggagcctccccggccccgcgccccc
ccgggagctccgggccctgggcctggctcgggagcccccggcagccaggaggaggaggag
gagccgggactggtggagagtgacccgggggacggcgccattgaggacccggaactggaa
gcgattaaagcgcgagtcagagagatggaggaagaagctgagaagctgaaggagctacaa
aacgaggtagagaagcagatgaatatgagtccacctccaggcaatgctggcccagtgatt
atgtctattgaggagaagatggaggctgatgcccgttccatctatgttggcaatgtggac
tatggtgcaacagcagaagagctggaagcacactttcatggctgtggctcagtgaaccgt
gttactatactctgtgacaaatttagtggccaccccaaagggtttgcatatatagagttc
tcagacaaagagtcagtgaggacttccctggccttagatgagtccctatttagaggaaga
caaatcaaggtgatcccaaaacgaaccaacagaccaggcatcagcacaacagacaggggt
ttcccacgagcccgataccgtgcccggaccaccaactacaacagttctcgctctcgattc
tacagtggtttcaacagcaggccccggggtcgcatctacaggggccgggctagagcgact
tcatggtattccccttactaa

DBGET integrated database retrieval system