KEGG   Hipposideros armiger (great roundleaf bat): 109389297
Entry
109389297         CDS       T04661                                 

Gene name
CCND1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01522  Endocrine resistance
hai04068  FoxO signaling pathway
hai04110  Cell cycle
hai04115  p53 signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04152  AMPK signaling pathway
hai04218  Cellular senescence
hai04310  Wnt signaling pathway
hai04340  Hedgehog signaling pathway
hai04371  Apelin signaling pathway
hai04390  Hippo signaling pathway
hai04510  Focal adhesion
hai04530  Tight junction
hai04630  JAK-STAT signaling pathway
hai04917  Prolactin signaling pathway
hai04919  Thyroid hormone signaling pathway
hai04921  Oxytocin signaling pathway
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai04934  Cushing syndrome
hai05160  Hepatitis C
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05169  Epstein-Barr virus infection
hai05200  Pathways in cancer
hai05203  Viral carcinogenesis
hai05205  Proteoglycans in cancer
hai05206  MicroRNAs in cancer
hai05210  Colorectal cancer
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05216  Thyroid cancer
hai05218  Melanoma
hai05219  Bladder cancer
hai05220  Chronic myeloid leukemia
hai05221  Acute myeloid leukemia
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
hai05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109389297 (CCND1)
   04340 Hedgehog signaling pathway
    109389297 (CCND1)
   04390 Hippo signaling pathway
    109389297 (CCND1)
   04371 Apelin signaling pathway
    109389297 (CCND1)
   04630 JAK-STAT signaling pathway
    109389297 (CCND1)
   04068 FoxO signaling pathway
    109389297 (CCND1)
   04151 PI3K-Akt signaling pathway
    109389297 (CCND1)
   04152 AMPK signaling pathway
    109389297 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109389297 (CCND1)
   04115 p53 signaling pathway
    109389297 (CCND1)
   04218 Cellular senescence
    109389297 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109389297 (CCND1)
   04530 Tight junction
    109389297 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    109389297 (CCND1)
   04921 Oxytocin signaling pathway
    109389297 (CCND1)
   04919 Thyroid hormone signaling pathway
    109389297 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109389297 (CCND1)
   05206 MicroRNAs in cancer
    109389297 (CCND1)
   05205 Proteoglycans in cancer
    109389297 (CCND1)
   05203 Viral carcinogenesis
    109389297 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109389297 (CCND1)
   05212 Pancreatic cancer
    109389297 (CCND1)
   05225 Hepatocellular carcinoma
    109389297 (CCND1)
   05226 Gastric cancer
    109389297 (CCND1)
   05214 Glioma
    109389297 (CCND1)
   05216 Thyroid cancer
    109389297 (CCND1)
   05221 Acute myeloid leukemia
    109389297 (CCND1)
   05220 Chronic myeloid leukemia
    109389297 (CCND1)
   05218 Melanoma
    109389297 (CCND1)
   05219 Bladder cancer
    109389297 (CCND1)
   05215 Prostate cancer
    109389297 (CCND1)
   05213 Endometrial cancer
    109389297 (CCND1)
   05224 Breast cancer
    109389297 (CCND1)
   05222 Small cell lung cancer
    109389297 (CCND1)
   05223 Non-small cell lung cancer
    109389297 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109389297 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109389297 (CCND1)
   04934 Cushing syndrome
    109389297 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109389297 (CCND1)
   05162 Measles
    109389297 (CCND1)
   05160 Hepatitis C
    109389297 (CCND1)
   05163 Human cytomegalovirus infection
    109389297 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109389297 (CCND1)
   05169 Epstein-Barr virus infection
    109389297 (CCND1)
   05165 Human papillomavirus infection
    109389297 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109389297 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109389297
NCBI-ProteinID: XP_019510241
LinkDB
Position
Un
AA seq 295 aa
MAHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPVAEDNKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLHLGSSNSFLSYHRLTRFLSKVIKCD
PDCLRACQEQIEALLESSLRQAQQQDLDPKAAEEEEEEEELDLACTPTDVRDVNI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggcacaccagctcctgtgctgcgaggtggagaccatccgccgggcataccccgatgcc
aaccttcttaacgatcgggtgctgcgagccatgctcaaggcggaggagacctgcgcgccc
tccgtgtcctacttcaagtgtgtgcagaaggagatcctgccgtccatgcggaagattgtg
gccacctggatgctggaggtctgcgaggagcagaagtgcgaggaggaggtcttcccgttg
gccatgaactacctggaccgcttcctgtccctggagccggtgaaaaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcctcgaagatgaaagagaccatccccctgacg
gccgagaagttgtgcatctacactgacaactccatccggcccgacgagctgctgcaaatg
gagctgctgctggtgaacaaactcaagtggaacttggccgccatgaccccgcacgatttc
atcgaacacttcctctccaaaatgccggtggcggaggacaacaaacagatcatccgcaaa
cacgcgcagaccttcgttgccctctgtgccacagacgtgaagttcatttccaacccgccc
tccatggtggctgctgggagcgtggtggcggcagtgcaaggcctgcacctgggaagttct
aacagcttcctgtcttatcaccgcctcacgcggttcctctccaaagtgattaagtgtgac
ccggactgccttcgggcctgccaggagcagatcgaagccctgctggagtcgagcctgcgc
caggcccagcagcaggacctggaccccaaggccgccgaggaggaggaagaggaggaggag
ctggacctggcctgcacgcccaccgacgtgcgggatgtgaacatttga

DBGET integrated database retrieval system