KEGG   Hipposideros armiger (great roundleaf bat): 109389333
Entry
109389333         CDS       T04661                                 

Gene name
CDH1
Definition
(RefSeq) cadherin 1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04015  Rap1 signaling pathway
hai04371  Apelin signaling pathway
hai04390  Hippo signaling pathway
hai04514  Cell adhesion molecules
hai04520  Adherens junction
hai05100  Bacterial invasion of epithelial cells
hai05200  Pathways in cancer
hai05213  Endometrial cancer
hai05216  Thyroid cancer
hai05218  Melanoma
hai05219  Bladder cancer
hai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109389333 (CDH1)
   04390 Hippo signaling pathway
    109389333 (CDH1)
   04371 Apelin signaling pathway
    109389333 (CDH1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109389333 (CDH1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109389333 (CDH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109389333 (CDH1)
  09162 Cancer: specific types
   05226 Gastric cancer
    109389333 (CDH1)
   05216 Thyroid cancer
    109389333 (CDH1)
   05218 Melanoma
    109389333 (CDH1)
   05219 Bladder cancer
    109389333 (CDH1)
   05213 Endometrial cancer
    109389333 (CDH1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    109389333 (CDH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hai03036]
    109389333 (CDH1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hai04515]
    109389333 (CDH1)
   04090 CD molecules [BR:hai04090]
    109389333 (CDH1)
Chromosome and associated proteins [BR:hai03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    109389333 (CDH1)
Cell adhesion molecules [BR:hai04515]
 Cadherins
  Major cadherins
   109389333 (CDH1)
CD molecules [BR:hai04090]
 Proteins
  109389333 (CDH1)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro BACON_2 Big_9 DUF4999 Cadherin_3
Other DBs
NCBI-GeneID: 109389333
NCBI-ProteinID: XP_019510305
LinkDB
Position
Un
AA seq 903 aa
MGPRCLSLSALGARPAMGARCFSLSVLLLLLQVSSWRCQEPEPCRPGFGAESYTFTVPRR
HLERGRVLGRVSFEGCTGQPRTIYISDDTRFKVGTDGVLTVKRPLQLHNSEIRFLVHAWD
STRRKLSTQVTLKAAVPNHRHRHHHHNVCCSVSGKFTNILVFVSSHHGLRRQKRDWVIPP
ISCPENEKGPFPKKLVQIKSNKDKETQVFYSITGQGADAPPVGIFIIERETGWLKVTEPL
DREAIAKYTLYSHAVSSNGNAVEDPMEIVITVTDQNDNRPVFTQQVFEGSVMEGALPGTS
VMQVSATDADDEVNTYNAAIYYDILSQDPEMPDKKMFTINRETGVISVLTTGLDCESISK
YTLVVQAADLQGEGLSTTAEAVITVTDINDNPPIFNPTTYQGQVLENEAFVTIATLKVTD
ADLPNTPAWEAVYNILNNNEEQFVVTTDPVTNDGILKTAKGLDFEAKQQYILYVTVENVA
PFEVTLSTSTATVTVDVLDVNEAPIFVPPQKRVEVSEDFPVGQEITSYTAQDPDTFMEQK
ITYRIWRDTANWLEIDPDTGAISTRAEMDREDIEHVKNSTYTALIIATDNGSPLATGTGT
LLLILSDVNDNAPVPEPRNMDFCQRNPQPHIINIIDPDLPPNTSPFTAELTHGASVNWTI
EYNDPEHESLILKPRKTLELGDYKINLKLADNQNKDQVTTLDVFVCDCEGAVNSCKRNMA
YAEAGLQVPAILGILGGILALLILILLLLLFIRRKRVVKEPLLPPEDDTRDNIYYYDEEG
GGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPQYRPRPANPDEIGNFIDENLKAAD
SDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDRDQDYDYLNEWGNRFKKLADMYGGG
EDD
NT seq 2712 nt   +upstreamnt  +downstreamnt
atgggccctcggtgcctcagcctctccgcgctcggtgcccggcccgccatgggcgctcgg
tgcttcagcctgtccgtgctcctgctgctgctgcaggtctcatcatggcgctgccaggag
ccagagccctgccgtcctggctttggcgctgagagttacacgttcacggtgccccggcgg
cacttggagagaggccgagtcctgggcagagtgagttttgaaggatgcaccggtcaacca
aggacaatctatatttctgacgacaccagattcaaagtgggcaccgatggtgtgcttaca
gtcaaacggcctctacaactgcataattcagagattaggtttcttgttcacgcctgggac
tccacccgcaggaagctgtccacccaagtgacgctgaaggcagcagtgcccaaccaccgg
catcgccaccatcatcataatgtatgttgcagtgtttctggaaagttcactaatatttta
gtctttgtttcatcccaccatggtctcagaagacagaagagagactgggttattcctcct
atcagctgcccagaaaatgaaaaaggcccatttcctaagaagctggttcagatcaaatct
aacaaggacaaagaaacacaggttttctacagcatcactggccaaggagctgacgcaccc
cctgttggtatctttattattgaaagagaaacaggatggctaaaggtgacagaacctctg
gatagagaagctattgccaagtacactctctactctcatgctgtgtcttcaaatgggaat
gcagttgaggacccgatggagattgtgatcacagtgacagatcagaatgacaacaggcca
gtgtttacccagcaggtctttgagggatctgtcatggaaggtgctcttccaggaacctcc
gtgatgcaggtctcggccacagatgccgacgacgaagtgaacacctacaatgctgccatt
tattatgacatcctctcccaagatcccgagatgcctgacaagaaaatgttcaccatcaac
agggaaacaggagtcatcagcgtgctcaccactgggctggactgtgagagtatttccaag
tataccctggtggttcaagctgctgaccttcaaggtgaaggcttaagcacaaccgcagaa
gctgtgatcacggtcactgacatcaacgacaaccctccgatcttcaacccgaccacgtac
caggggcaagttcttgagaatgaggcttttgtcacaatcgctaccctcaaagtgactgat
gctgacctgcccaataccccggcgtgggaggctgtatacaacatattaaataacaacgag
gagcaatttgttgtcaccacagacccagtaaccaacgacggcattttgaaaacggctaag
ggcttggattttgaggcgaaacagcaatacattctctacgtgacagtagagaatgtggcc
ccctttgaggtcactctgtccacgtccacagccaccgtcaccgtggatgtgctggatgtg
aacgaagcccccatcttcgtgcctcctcaaaagagagtggaggtgtccgaagactttcca
gtgggacaggaaatcacatcctacactgcccaggatccagacacatttatggaacagaag
ataacgtatcggatttggagggacactgccaactggctggagattgatccggacactggt
gccatttccactcgggctgagatggacagagaggacattgagcatgtgaagaacagcaca
tacacagccctcattatagccactgacaatggttctccacttgctactggaacgggaacc
cttctcttgatcctctccgatgtgaatgacaatgcccccgttccagaacctcgaaacatg
gacttctgccagaggaatccacagcctcatatcatcaacattattgatccagaccttccc
cccaacacatctcccttcacagcagagctgacacacggggcaagtgtcaactggaccatt
gagtacaatgacccagaacacgaatctctcattttgaagccaaggaaaaccttggagttg
ggtgactacaaaataaatctcaagctcgcagataaccagaacaaagaccaggtgaccacc
ttggacgtctttgtgtgtgactgtgaaggggccgtcaacagctgtaagaggaacatggct
tatgccgaagctgggttgcaggtccctgccatcctggggattcttggaggcatccttgct
ttgctaatcctgattctgctgctcctgctgtttattcggagaaaacgggtggtcaaagag
cccttactgcccccagaagacgacacccgggataacatttattactatgatgaagaagga
ggtggagaagaggaccaggactttgacttgagccagttgcacaggggcctggatgctcgg
cccgaagtgactcgcaatgacgtggcaccaaccctcatgagtgtgccccagtatcggccc
cggcctgccaatcctgatgaaattggaaactttatcgatgaaaacttgaaggcggccgat
agtgaccccacggctcctccttacgactctctgcttgtgtttgattatgaaggaagtggt
tccgaagctgctagtctgagctccctgaactcctcagagtcagaccgagaccaggactat
gactacctgaatgaatggggcaatcgctttaagaagctggcagatatgtacggaggtggc
gaggacgactag

DBGET integrated database retrieval system