KEGG   Hipposideros armiger (great roundleaf bat): 109389410Help
Entry
109389410         CDS       T04661                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00020  Citrate cycle (TCA cycle)
hai00190  Oxidative phosphorylation
hai01100  Metabolic pathways
hai01200  Carbon metabolism
hai04714  Thermogenesis
hai04932  Non-alcoholic fatty liver disease (NAFLD)
hai05010  Alzheimer disease
hai05012  Parkinson disease
hai05016  Huntington disease
Module
hai_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hai_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hai_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109389410 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    109389410 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    109389410 (SDHB)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    109389410 (SDHB)
   05012 Parkinson disease
    109389410 (SDHB)
   05016 Huntington disease
    109389410 (SDHB)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    109389410 (SDHB)
Enzymes [BR:hai01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     109389410 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 109389410
NCBI-ProteinID: XP_019510453
LinkDB All DBs
Position
Un
AA seq 290 aa AA seqDB search
MAAVVGVSLRRRFPATALGGACLQVSSGVAERGQACRGAQTAAAAAPRIKKFAIYRWDPD
KTGDKPHMQTYEIDLNKCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNT
LACTRRIDTNLSKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQY
LQSIEDREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEER
LAKLQDPFSLYRCHTIMNCTQTCPKGLNPGKAIAEIKKMMAAYKEKKAAA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtcggagtctccttgaggcgacgtttcccggccacagcccttggcgga
gcctgcctgcaggtgagctccggggtcgcggagagagggcaggcctgccgaggggcccag
acagctgcagccgcagctccccgaatcaagaaatttgccatctaccggtgggacccagac
aagactggagataaacctcatatgcaaacttatgagattgatttgaataaatgtggtcct
atggtgttggatgctttaatcaagattaagaatgaaattgattctaccttgaccttccga
cgatcatgcagagaaggtatctgtggctcctgtgcaatgaacatcaatgggggcaacact
ctcgcttgcacccgaaggattgacaccaacctcagcaaagtctcaaaaatctaccctctt
ccacatatgtatgtgataaaggaccttgttcctgatttgagcaacttctatgctcagtac
aaatccattgagccttatttgaagaagaaggatgaatcccaggaaggcaagcagcagtac
ctgcagtccatagaagatcgggagaaactggatgggctgtatgagtgcattctctgtgcc
tgctgcagcaccagctgcccgagctactggtggaatggagacaaatatttggggcctgca
gttcttatgcaggcctatcgctggatgatcgactccagagacgacttcacagaggagcgt
ctggccaagctgcaggacccgttctctctgtaccgctgccacaccatcatgaactgcaca
cagacctgtcccaaggggctgaatccaggcaaagctattgccgaaatcaagaaaatgatg
gcagcctacaaggagaagaaagctgcagcttaa

DBGET integrated database retrieval system