KEGG   Hipposideros armiger (great roundleaf bat): 109390202
Entry
109390202         CDS       T04661                                 

Gene name
DDB2
Definition
(RefSeq) damage specific DNA binding protein 2
  KO
K10140  DNA damage-binding protein 2
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai03420  Nucleotide excision repair
hai04115  p53 signaling pathway
hai04120  Ubiquitin mediated proteolysis
hai05161  Hepatitis B
hai05169  Epstein-Barr virus infection
hai05200  Pathways in cancer
hai05202  Transcriptional misregulation in cancer
hai05210  Colorectal cancer
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05214  Glioma
hai05216  Thyroid cancer
hai05217  Basal cell carcinoma
hai05218  Melanoma
hai05220  Chronic myeloid leukemia
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109390202 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    109390202 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109390202 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109390202 (DDB2)
   05202 Transcriptional misregulation in cancer
    109390202 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109390202 (DDB2)
   05212 Pancreatic cancer
    109390202 (DDB2)
   05225 Hepatocellular carcinoma
    109390202 (DDB2)
   05226 Gastric cancer
    109390202 (DDB2)
   05214 Glioma
    109390202 (DDB2)
   05216 Thyroid cancer
    109390202 (DDB2)
   05220 Chronic myeloid leukemia
    109390202 (DDB2)
   05217 Basal cell carcinoma
    109390202 (DDB2)
   05218 Melanoma
    109390202 (DDB2)
   05213 Endometrial cancer
    109390202 (DDB2)
   05224 Breast cancer
    109390202 (DDB2)
   05222 Small cell lung cancer
    109390202 (DDB2)
   05223 Non-small cell lung cancer
    109390202 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    109390202 (DDB2)
   05169 Epstein-Barr virus infection
    109390202 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hai04121]
    109390202 (DDB2)
   03400 DNA repair and recombination proteins [BR:hai03400]
    109390202 (DDB2)
Ubiquitin system [BR:hai04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     109390202 (DDB2)
DNA repair and recombination proteins [BR:hai03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      109390202 (DDB2)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40
Other DBs
NCBI-GeneID: 109390202
NCBI-ProteinID: XP_019511912
LinkDB
Position
Un
AA seq 427 aa
MAPKKRPETRKTLEVVVRPKSNRSRSPRELEPEAKKLNVKGPGSSRRFDSGCLWVELAGL
RVPPPCRGIVRALHHHKLGRGAWPSLQQCLQQSFLHSLASYRIFHKAAPFDRRATSLAWH
PTHPSTLAVGSKGGDIILWNFGIKDKPTFIEGIGAGGSITGLKFNPLNTNQFFASSVEGT
TRLQDFQGNTLQVLTSYNTCNFWFCSLDVSAKSRVVVTGDNVGHVILLNMDGKELWNLRM
HKKKVTHVALNPCCDWLLATASVDQTVKIWDLRQVKGKSSFLYSLPHKHPVNAAHFSPDG
AQLLTTDQKSEIRVYSASQWDCPPSLIPHPHRHFQHLTPIKAAWHPRYNLIVVGRYPDPN
FKSCNPYELRTIDVFDGSSGKLMHQLYDPESSGIISLNEFNPMGDTLASVMGYHILIWSQ
EEAVMRK
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggctcccaagaagcgcccagaaacccggaagaccctcgaggtggttgtgcgccccaag
agcaacaggagcagaagcccccgggagctggagcccgaggccaagaagctcaatgtgaag
ggccccggttctagcagaagatttgactcaggctgcctttgggtagagttggctggcctg
cgggtcccgccaccgtgcaggggcatcgtcagggccctccatcaccataagctgggcaga
ggtgcttggccatcactacagcagtgtctccagcagtcctttttgcactcgctggcttct
taccggatattccataaggctgccccatttgacagaagggctacatccttggcatggcac
ccaactcaccccagcaccctggctgtgggttccaaagggggagatatcattctctggaac
tttggcataaaggacaaacctaccttcattgaagggattggagctggagggagcatcact
gggctgaagtttaaccctctcaataccaaccagtttttcgcctcgtccgtggagggaaca
acgaggctgcaagactttcaaggcaacactctccaagttctcaccagctacaatacctgc
aacttctggttttgcagcctggatgtgtctgccaaaagccgagtggtggtcacaggggac
aatgtggggcacgtgatcctgctgaacatggacggcaaggagctttggaatctgagaatg
cacaaaaagaaagtgacccatgtggccctaaatccatgctgtgattggctcctggccaca
gcctccgtcgatcaaacagtgaaaatctgggacctgcgccaggtgaaagggaaatccagc
ttcctctactcactgccgcacaagcaccctgtcaatgcagctcatttcagtcctgatgga
gcccagctgctgaccactgaccagaagagtgagatccgggtttactctgcctcccagtgg
gactgccccccgagcctgatcccacaccctcaccgccacttccagcacttgacgcccatc
aaggcagcctggcaccctcggtacaacctcattgttgtgggcagatacccagatcctaat
ttcaaaagctgtaacccctatgaattaaggacaatcgatgtgtttgatggaagctcaggg
aagttgatgcatcagctctatgacccagaatcttctggtatcatttcgctcaatgagttc
aatcctatgggggacacgctggcctctgtgatgggttatcacattctcatttggagccag
gaggaagctgtaatgcggaaatga

DBGET integrated database retrieval system