KEGG   Hipposideros armiger (great roundleaf bat): 109390379Help
Entry
109390379         CDS       T04661                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00250  Alanine, aspartate and glutamate metabolism
hai00410  beta-Alanine metabolism
hai00430  Taurine and hypotaurine metabolism
hai00650  Butanoate metabolism
hai01100  Metabolic pathways
hai04727  GABAergic synapse
hai04940  Type I diabetes mellitus
Module
hai_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    109390379 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109390379 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109390379 (GAD1)
   00430 Taurine and hypotaurine metabolism
    109390379 (GAD1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    109390379 (GAD1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    109390379 (GAD1)
Enzymes [BR:hai01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     109390379 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1 SepSecS OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 109390379
NCBI-ProteinID: XP_019512334
LinkDB All DBs
Position
Un
AA seq 594 aa AA seqDB search
MASSTPSSSASSSNAGADPNTANLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKERQSSKNLISCENSDRDGRFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
NKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAA
LGFGTDNVILIKCNERGKIIPADLEAKILEAKQKGYVPLYVNATAGTTVYGAFDPIQEIA
DICEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI
NKCLELAEYLYAKIKNREEFEMVFNGEPEHTNVCFWYIPQSLRGVLDSPERREKLHRVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcgaccccttcttcgtccgcatcctcttcgaacgcgggagcggatcccaat
actgccaacctgcgccccacaacgtatgacacctggtgcggcgtggctcatggatgtacc
agaaaactggggctcaagatctgcggcttcttgcaaaggaccaacagcctggaggagaag
agccggcttgtgagcgccttcaaggagaggcagtcctccaagaacctgatttcctgtgaa
aacagtgacagggatggccgctttcggcgcacggagaccgacttttccaacctgtttgct
cgagatctgcttccggctaagaacggggaggagcaaactgtgcagttcctactggaggtg
gtggacatactcctcaactatgtccgcaagacattcgatcgctccaccaaggtgctggat
ttccatcacccacaccagctgctggaaggcatggagggcttcaatttggagctctccgac
catcctgagtccctggagcagatcctggttgactgcagagacaccctgaagtatggggtt
cgcacaggtcatcctcgatttttcaaccagctctccactggactggatatcattggttta
gccggagaatggctgacatcaactgctaataccaatatgtttacatatgaaattgctcca
gtgtttgtcctcatggagcaaataacgctcaagaagatgagagagatagttggatggtca
aataaagatggtgatgggatcttttctcctgggggagccatatccaacatgtacagcatc
atggctgctcgctacaagtacttcccggaagttaagacaaagggcatggcggccgtgccc
aaactggtcctcttcacctcagaacatagtcactattccataaagaaagctggagctgca
cttggctttggaactgacaatgtgattttgataaagtgcaatgaaagggggaagataatt
cctgctgatttagaggcaaaaattcttgaagccaagcaaaagggatatgttcctctttat
gtcaatgcgactgctggcacaaccgtttatggcgcctttgatccgatacaggagattgca
gatatatgtgagaaatataacctttggctgcatgtcgatgctgcctggggcggtgggctg
ctcatgtccaggaagcaccgccataaactcagtggcatcgaaagggccaactcagtcacc
tggaaccctcacaagatgatgggtgtgctgttgcagtgctctgccattcttgttaaggaa
aaggggatactccaaggatgcaaccagatgtgtgcaggatacctcttccagccagacaag
caatatgatgtgtcctatgacacgggggacaaggcaattcagtgtggccgccatgtggac
attttcaagttctggctgatgtggaaagcaaagggcacagtgggatttgaaaatcagatc
aacaaatgcttggaactggctgaatacctctatgccaagattaaaaacagagaagaattt
gagatggtcttcaacggtgagcctgagcataccaacgtctgtttctggtatattccacaa
agcctccggggcgtgctggatagcccagagcgccgggaaaaactacacagggtggctcca
aaaatcaaagccctgatgatggagtctggcacgaccatggttggctaccagcctcagggg
gacaaggccaacttcttccggatggtcatctcgaacccagccgcaacccagtctgacatc
gacttcctcattgaggagatagaaagactgggccaggatctgtaa

DBGET integrated database retrieval system