KEGG   Hipposideros armiger (great roundleaf bat): 109390599Help
Entry
109390599         CDS       T04661                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Brite
KEGG Orthology (KO) [BR:hai00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hai01002]
    109390599 (TMPRSS9)
Enzymes [BR:hai01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     109390599 (TMPRSS9)
Peptidases [BR:hai01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   109390599 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 Ldl_recept_a SEA
Motif
Other DBs
NCBI-GeneID: 109390599
NCBI-ProteinID: XP_019512782
LinkDB All DBs
Position
Un
AA seq 1125 aa AA seqDB search
MLTESSAPVITAVRQESGAVAEWQRPRLGPGDHRVNRQRWLSGGLEAMEPTIGELQLMPV
ATKEVPAQDTACCRAALSAAVATSIVIVTLAVFVAPLSTQGFDVEHTAELQGIRYACSLQ
QEASGYYRTLTPTLETLFVSSFWKTELEASCVGCTVLSYRDGNSSVLVRFRLHFLLLALR
SLDLALEQELLQQGLRARLQGHGVPLGAHGTIVSAKLTGSQKGPLTERDLKSGRCPGNAF
SCSDSQCVTKVNPECDDKVDCSDGSDEAHCDCGLQPGWRTAGRIVGGMEASPGEFPWQVS
LRENSEHFCGAAVIGARWLVSAAHCFNEFQDPTEWVAYAGTTHLSGSEASTVRVRVVQII
THPSYNSDTADFDVAVLRLGSPLPFSRHIQPVCLPAASHIFPPRKKCLISGWGYLKEDFL
VKPEMLQKATVELLDQALCASLYGHSLTDQMVCAGYLDGKVDSCQGDSGGPLVCEEPSGR
FFLAGIVSWGIGCAEARRPGVYARVTRLRDWILEAIAMASKPLAPTVDPAPTTPSTVWPT
SPESRVVDTPTKPTLAPSSVPLDSMTASKPQECGARPAMEKPPRIVGGLGAIAGEVPWQV
SLKEGSRHFCGATVVGDRWLLSAAHCFNHTKVELVRAHLGTVSLTGIGGSPVKMGLKRAV
LHPQYNPSILDFDVAVLELARPLVFNKYIQPICLPLAIQKFPAGRKCMISGWGNMQEGNA
TKPDTLQQASVGIIDQKVCSVLYNFSLTDRMLCAGFLEGKVDSCQGDSGGPLACEETPGV
FYLAGIVSWGIGCAQAKKPGVYTRITRLKDWILDTMSSQPLPTPAPSTTRTPATSSYAPR
TTAGFTVLGVTASRPTLRATSQPANRTATAMSTTARGHTPLPNVPWTTMGSQLPADCGLA
PVAALTRIVGGSAAGRGEWPWQVSLWLRRREHRCGAVLVAERWLLSAAHCFDVYGDPKQW
AAFLGTPFLSGADGQLERVARIYKHPFYNLYTLDYDVALLELAAPVRRNRLVRPICLPEP
APQPLDGARCIITGWGSVREGGTRGRVPAPSGTKGPGASGRPPAPPVRLACRLHGAAAAE
SSGAPPQRAGLSPLLSGADQQPHAVRRLPARRRGQLLRECTLQLK
NT seq 3378 nt NT seq  +upstreamnt  +downstreamnt
atgcttacagaaagctctgctcctgttatcacagctgttcgtcaagagtctggagctgtg
gcagagtggcagaggccccgcctgggacctggggaccacagagtgaacaggcagaggtgg
ctgtccgggggtctggaagccatggagcccaccattggtgaattacagctcatgcccgtg
gcaacaaaggaagtccctgctcaggacaccgcatgctgccgagcagccctgtccgctgca
gtggccaccagcattgtcattgtcaccctggcggtctttgtggcccccctctctacacag
ggcttcgatgtggagcacaccgctgagctgcagggcatccggtacgcctgcagccttcag
caggaggcctccggctactaccgcacgctgacgcccactctggaaacgctgtttgtaagc
agcttttggaagacagagttggaggccagctgcgtgggctgcacagtgctaagttacaga
gatgggaactccagtgtcctagtgcgtttccggctacacttcctgctgttggccctgcgg
tcactggatctggccctggaacaagagctgctgcagcaggggctccgagcaaggctgcag
ggccacggcgtcccactaggtgcccacggcaccatcgtgtctgccaagctcacaggaagc
cagaaggggcctttgacagaaagagacttgaaatcaggtcgctgtccagggaacgccttc
tcctgcagcgacagccagtgtgtgaccaaagtgaacccggaatgtgatgacaaagtggac
tgttctgatggatccgacgaggcccactgcgactgcggtttgcagccgggctggaggaca
gctggcaggattgtgggtggcatggaagcatcgcccggggagttcccttggcaagtcagc
ctccgagaaaacagcgagcacttctgtggggccgcggtgatcggggccaggtggctggtg
tctgccgcccactgcttcaatgagttccaagaccccactgagtgggtggcctatgcgggc
accacccacctcagcggctcggaagccagcacggtgcgggtccgcgtggtgcagatcatc
acgcacccctcctacaactccgacaccgccgactttgatgtggcggtgctgcgtctgggc
agccccctgcccttcagcaggcacatccagcccgtgtgcctgccagccgcctcacacata
ttcccgcccaggaagaagtgtctgatctcgggctggggctacctcaaggaggacttcctg
gtcaagccggagatgctgcagaaagccaccgtggagctgctggaccaggccttgtgcgcc
agcctgtacgggcactcgctcacggaccagatggtgtgtgctggctacctggatgggaag
gtggattcctgccagggtgactcgggaggccccctggtctgtgaggagccctctggcagg
ttcttcctggccggcatcgtgagctggggcattggttgtgcagaagcccggcgtccggga
gtttatgcccgagtgaccaggctgcgagactggatcctggaggcgattgccatggcaagc
aagcctctggcccccacggtggatcctgcccccaccacccccagtactgtctggcccacc
agccctgagagccgggtggtcgacacccccaccaaacccacgctggcccccagctctgtg
cctcttgactcaatgactgcttctaagccacaagagtgtggggccaggccggcgatggag
aaacctccccggatcgtgggggggttaggagccattgctggggaggtgccttggcaagtc
agcctgaaggaaggttcccggcacttctgtggagcgacagtggtaggggaccgctggctg
ctgtcggcagcccactgcttcaaccacacgaaggtggagctggtgcgggcccacctgggc
accgtgtccctcacgggcattggtgggagcccagtgaaaatggggctcaagagggcagtg
ctgcatccccagtacaaccccagcatcctggactttgacgtggctgtcctggagctggcc
cggcccctggtcttcaacaagtacatccagcccatctgcctgcccctggccatccagaag
ttccctgcaggccgcaagtgcatgatctctggctggggtaacatgcaggagggaaatgca
acgaagcctgacactcttcagcaagcgtccgtgggcatcatagatcagaaggtgtgcagc
gtgctctacaacttctcgctgacggacaggatgctctgtgccggcttcctggagggcaag
gtggactcctgccagggtgattctgggggacctctggcctgtgaggagacccctggtgtg
ttttatctggcggggattgtcagctgggggatcggctgtgctcaggccaagaaacccgga
gtgtacacacgaatcaccaggctgaaggactggatcctggacaccatgtcctcccagccc
ctccccacacctgccccctccaccacaaggacacctgccaccagcagctatgctcccagg
acaacagcaggcttcacagtcctgggtgtaacagccagcagacccaccctccgggccacc
agccaacctgccaataggaccgccactgctatgagcaccactgctagggggcacacgcca
cttccaaatgtgccatggaccaccatgggctcccagctaccagcagactgcggcctggcg
ccagtggcagcactgaccaggatcgtgggtggcagcgccgcgggtcgcggggagtggccg
tggcaggtgagcctgtggctgcggcgccgggagcaccgctgcggggccgtgctggtcgct
gagaggtggctgttgtctgcggcgcactgcttcgacgtctacggggaccccaagcagtgg
gcagccttcctgggcactccgttcctgagcggcgccgacgggcagctggagcgtgtggcg
cgtatctacaagcatcccttctataacctctacacgctcgactacgatgtggcgctgctt
gagctggcggcgcctgtgcgccgtaaccgcctggtgcgacccatctgcctgccggagccc
gcaccccaacccctcgatggcgcgcgctgcatcatcactggctggggctcggtgcgtgaa
ggaggtacgcgtggtcgggtccctgcaccctcggggactaagggcccgggggcgtcggga
aggcccccagccccaccggttcgtctcgcttgcaggctccatggcgcggcagctgcagaa
agcagcggtgcgcctcctcagcgagcaggcctgtcgccgctactatccggtgcagatcag
cagccgcatgctgtgcgccggcttcccgcacggcggcgtggacagctgctccgtgagtgc
actctgcagttgaaatag

DBGET integrated database retrieval system