KEGG   Hipposideros armiger (great roundleaf bat): 109390993Help
Entry
109390993         CDS       T04661                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai03030  DNA replication
hai03410  Base excision repair
hai03420  Nucleotide excision repair
hai03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:hai00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    109390993 (LIG1)
   03410 Base excision repair
    109390993 (LIG1)
   03420 Nucleotide excision repair
    109390993 (LIG1)
   03430 Mismatch repair
    109390993 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hai03032]
    109390993 (LIG1)
   03400 DNA repair and recombination proteins [BR:hai03400]
    109390993 (LIG1)
Enzymes [BR:hai01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     109390993 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     109390993 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     109390993 (LIG1)
DNA replication proteins [BR:hai03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    109390993 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     109390993 (LIG1)
DNA repair and recombination proteins [BR:hai03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     109390993 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     109390993 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     109390993 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR PucR
Motif
Other DBs
NCBI-GeneID: 109390993
NCBI-ProteinID: XP_019513696
LinkDB All DBs
Position
Un
AA seq 700 aa AA seqDB search
SSPSPMRISPSGIPKRRTARKQLSKRTIHDVLEEKSEDKNGEANKAVPREVWDGGWVRHV
MCVSFPRVPYLAVARTFEKIEEVSARLRIVETLSNLLRSVVALSPPDLLTILYLSLNHLG
PPQQGLELGVGDGVLLKAVAQATGRQLESVRAEAAEKGDVGLVAENSRSTQRLMLPPPAL
TASGVFAKFQDIARLTGSASTAKKIDIIKGLFVACRHSEARFIARALSGRLRLGLAEQSV
LAALAQAVSLTPPGQEFPPAMVDAGKGKTAEARKTWLEEQGMVLKQTFCEVPDLDRIVPV
LLEHGLERLPAHCSLSPGVPLKPMLAHPTRGVSEVLKRFEEAAFTCEYKYDGQRAQIHVL
EGGEVKVFSRNQEDNTGKYPDVISRIPKIKRPSVTSFILDTEAVAWDREKKQIQPFQVLT
TRKRKEVDAAEIQVQVCLYAFDLIYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSL
DTKDTDQIAEFLEQSVRDSCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDL
VVIGAYLGRGKRAGRYGSFLLASYDEESEELQAICKLGAGFSDEELEQHHQSLQALVLPT
PRSYVRADGAVAPDYWLEPSAVWEVKCADLSLSPIYPAARGLVDSEKGISLRFPRFIRIR
EDKKPEEATTSAQVAGLYRKQSQIQNQQSADLDSDLEDFY
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
tctagtccctctccaatgcgcatctccccatcagggatcccgaagcgtcgcacagctcgg
aagcagctgtctaaacggacaattcacgatgttctggaagagaagagtgaggacaagaat
ggagaagccaacaaggctgtccctagggaggtgtgggatggcggctgggtaaggcacgtc
atgtgtgtctctttccctagggtcccttatctggctgtggcccggacctttgagaagatc
gaggaggtttctgctcggctccggatagtggagacgctgagcaacttgctgcgctctgtg
gtggccctgtcacctccagacctcctcaccatcctctaccttagcctcaaccaccttggg
ccgccccagcagggcctggagcttggtgtcggggacggcgtccttctcaaggcagtggcc
caggccacaggtcggcagctcgagtctgtccgggctgaggcagccgaaaagggcgacgtg
gggctggtcgctgagaacagccgcagcacccagagactcatgctgcccccgcccgccctc
accgcctctggggtcttcgccaaattccaagacattgcccggctcactggcagcgcttcc
acagccaagaaaatagacatcatcaaaggcctgtttgttgcctgccgccactcagaagcc
cgatttattgccagagccctgagtggacggctgcgcctcggtctggcagagcagtcggtg
ctggctgccctcgctcaggctgtgagcctcacacccccaggccaagaattccccccagcc
atggtggatgctgggaagggcaagacagcagaggccagaaagacgtggctggaggagcaa
ggcatggtcctgaagcagacattctgtgaggtacctgacctggaccggattgtccccgtg
ctgctggagcatggcctggagcggctcccggcgcactgcagtctgagtccaggggtcccc
ctgaaaccaatgttggctcacccgacccggggcgtcagcgaggtcctgaaacgctttgag
gaggcagctttcacctgcgagtacaaatacgatgggcagagggcacagattcatgtttta
gaaggcggggaggtgaaagtcttcagcaggaatcaggaagacaatactggaaagtacccc
gacgtcatcagccgcatccccaagattaaacgtccgtcagtcacatcctttatcctggac
actgaagccgtggcttgggaccgggagaagaagcagatccagccatttcaagtgctcacc
acccgcaaacgcaaggaggtggatgcagccgagatccaggtgcaggtgtgtttgtatgcc
ttcgacctcatctacctcaatggagagtctctggtacgtgagcccctttcccgacgccgg
cagctgctccgggagaacttcgtggaaacggagggcgagtttgtcttcgccacgtccctg
gacaccaaggacacagaccagatcgccgagttcttggagcagtctgtgagagactcctgc
gaggggctgatggtgaaaaccctggatgtcgatgccacctacgagatcgccaagagatca
cacaactggctcaagctgaagaaggactatctggacggtgtgggtgacacccttgacctc
gtggtgatcggcgcctacctgggccgggggaagcgggctggccgctatgggagcttcctg
ctggcctcctatgatgaggaaagcgaggagctgcaggccatttgcaagcttggagctggc
ttcagtgacgaggagctggagcagcatcaccagagcctgcaggccctggtgctgcccacc
ccacgctcctatgtccgggcagacggtgccgtggcccccgactactggctggagcccagc
gccgtgtgggaggtcaagtgtgctgatctctccctctcccccatctaccctgccgcccgg
ggcctggtggacagcgagaaggggatctccctacgcttccctcggtttattcgcatccgt
gaagacaagaagccggaggaggccaccaccagtgcccaggtggccggactgtacaggaag
caaagtcagattcagaaccagcagagtgctgacttagattccgacctggaggatttctac
tag

DBGET integrated database retrieval system