KEGG   Hipposideros armiger (great roundleaf bat): 109390996Help
Entry
109390996         CDS       T04661                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00500  Starch and sucrose metabolism
hai01100  Metabolic pathways
hai04151  PI3K-Akt signaling pathway
hai04152  AMPK signaling pathway
hai04910  Insulin signaling pathway
hai04922  Glucagon signaling pathway
hai04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:hai00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    109390996 (GYS1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    109390996 (GYS1)
   04152 AMPK signaling pathway
    109390996 (GYS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    109390996 (GYS1)
   04922 Glucagon signaling pathway
    109390996 (GYS1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    109390996 (GYS1)
Enzymes [BR:hai01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     109390996 (GYS1)
Glycosyltransferases [BR:hai01003]
 Polysaccharide
  Storage polysaccharide
   109390996 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 109390996
NCBI-ProteinID: XP_019513700
LinkDB All DBs
Position
Un
AA seq 761 aa AA seqDB search
MPLSRTLSMSSLPGLEEWEDDFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPSLKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCSIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQYLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVRVLAG
WVGHGRRVGGAWLHISHLLHYSRFRYHPSTLASDPLVERVYCDLRPAKKEKLRVHFSCLP
AAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFC
QQSRRQRIIQRNRTERLSDLLDWKYLGRYYMSARRLALSKAFPEHFTYEPQEADATQGYR
YPRPASVPPSPSLSRHSSPHLSEDEEDPQDRTPNEDSERYDEEEEAAKDRRNIRAPEWPR
RSPCSSISGSKRNSVDTAPSSSVSTPSEPLSPASSLGEERN
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgcctcttagccgcactttgtccatgtcctcactgccaggactggaggagtgggaagat
gatttcgacctggagaacacagtgctcttcgaggtggcctgggaagtggccaacaaggtg
ggcggcatctacacggtgctgcagacgaaggcgaaggtgacgggggatgagtggggcgac
aactactacctggtgggaccgtacacggagcagggcgtgaggacacaggtggaactgctc
gagcccccaactccatctctgaagaggacgctggactccatgaacagcaagggctgcaag
gtgtatttcgggcgctggctgattgaggggggccccctcgtggtactcctggacgtgggg
gcctcagcctgggccctggagcgctggaagggggaactctgggacacctgcagcattggg
gtgccctggtacgaccgtgaggccaacgatgccgtcctttttggcttccttaccacctgg
ttcctgggtgagttcctggcccagagcgaggagaagccacatgtggttgcacacttccac
gaatggttggcgggcgtcgggctctgcctgtgccgtgcccggcggctccctgtggctacg
atcttcaccacccatgccacgctgctggggcgatacctgtgtgccggtgctgtggatttc
tacaacaacctggagaatttcaatgtggacaaggaagctggtgagaggcaaatctatcac
cgctactgcatggagcgggcagcagcccactgcgctcacgtcttcactactgtgtcccag
attactgccatcgaggctcagtacctactcaagaggaaaccagatatcgtgactcccaat
ggactgaatgtgaagaagttctctgccatgcatgagttccagaacctccatgctcagagc
aaggcccgaatccaggagtttgtgcggggccatttttatgggcacctggacttcaacttg
gacaagaccttgtacttctttatcgctggccgctacgagttctccaacaaaggggccgac
gtcttcctggaggccttggcccggctcaactatctgctcagagtcaacggcagtgagcag
acagtagtcgccttcttcatcatgccggctcggaccaacaatttcaatgtggaaaccctc
aagggccaagccgtgcgcaagcagctttgggatacggccaacacagtgaaggagaagttc
gggaggaagctttacgaatcattgctggtggggagcctcccagacatgaacaagatgctg
gacaaggaggactttactatgatgaagagagccatctttgccacacagcggcagtctttt
ccccctgtgtgcacccacaatatgctggatgactcctcggaccccatcctgaccaccatc
cgccgaattggcctcttcaatagtagtgccgacagggtcaaggtgagggtactggctggg
tgggttgggcatggcaggagggtagggggagcctggcttcacatttcccatctgttgcat
tatagccgattccggtaccacccctctacattagcctctgacccattagtcgagagagtg
tactgcgacttaaggcctgcaaagaaggaaaagctaagggtgcatttctcatgccttccc
gcagctgagtgcacggttatgggcatccccagtatctccaccaacctttccggcttcggc
tgcttcatggaggaacacatcgcagacccctcagcttacggcatttacattctggaccgg
cggttccgcagtctggatgattcctgctcgcagctcacctccttcctctacagcttctgc
cagcagagcaggcggcagcgcatcatccagcggaaccgtactgaacgcctctctgacctt
ctggactggaaatacctaggccggtactatatgtctgcgcgccgcttggcgctgtccaag
gcctttccagaacacttcacctacgagccccaggaggctgatgcgacccagggctaccgc
tacccccggccagcctcggtgccaccatcgccttcactatctcgacactcgagccctcac
ctgagcgaggatgaggaggatccccaggacaggacgccaaatgaagacagcgagcgctac
gacgaggaagaggaggctgccaaggaccggcgcaatatccgtgccccggagtggccacgc
cgctccccctgctcttctatcagcgggagcaagcgcaactctgtggatactgcgccctcc
agctcagtcagcactcccagcgagcccctcagccccgccagctccctgggcgaggagcgc
aactga

DBGET integrated database retrieval system