KEGG   Hipposideros armiger (great roundleaf bat): 109391068
Entry
109391068         CDS       T04661                                 

Gene name
BAX
Definition
(RefSeq) BCL2 associated X, apoptosis regulator
  KO
K02159  apoptosis regulator BAX
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai01524  Platinum drug resistance
hai04071  Sphingolipid signaling pathway
hai04115  p53 signaling pathway
hai04141  Protein processing in endoplasmic reticulum
hai04210  Apoptosis
hai04211  Longevity regulating pathway
hai04215  Apoptosis - multiple species
hai04217  Necroptosis
hai04722  Neurotrophin signaling pathway
hai04932  Non-alcoholic fatty liver disease
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai05012  Parkinson disease
hai05014  Amyotrophic lateral sclerosis
hai05016  Huntington disease
hai05020  Prion disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05132  Salmonella infection
hai05152  Tuberculosis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05202  Transcriptional misregulation in cancer
hai05203  Viral carcinogenesis
hai05210  Colorectal cancer
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05214  Glioma
hai05216  Thyroid cancer
hai05217  Basal cell carcinoma
hai05218  Melanoma
hai05220  Chronic myeloid leukemia
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109391068 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    109391068 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109391068 (BAX)
   04215 Apoptosis - multiple species
    109391068 (BAX)
   04217 Necroptosis
    109391068 (BAX)
   04115 p53 signaling pathway
    109391068 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109391068 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    109391068 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109391068 (BAX)
   05202 Transcriptional misregulation in cancer
    109391068 (BAX)
   05203 Viral carcinogenesis
    109391068 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109391068 (BAX)
   05212 Pancreatic cancer
    109391068 (BAX)
   05225 Hepatocellular carcinoma
    109391068 (BAX)
   05226 Gastric cancer
    109391068 (BAX)
   05214 Glioma
    109391068 (BAX)
   05216 Thyroid cancer
    109391068 (BAX)
   05220 Chronic myeloid leukemia
    109391068 (BAX)
   05217 Basal cell carcinoma
    109391068 (BAX)
   05218 Melanoma
    109391068 (BAX)
   05213 Endometrial cancer
    109391068 (BAX)
   05224 Breast cancer
    109391068 (BAX)
   05222 Small cell lung cancer
    109391068 (BAX)
   05223 Non-small cell lung cancer
    109391068 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    109391068 (BAX)
   05014 Amyotrophic lateral sclerosis
    109391068 (BAX)
   05016 Huntington disease
    109391068 (BAX)
   05020 Prion disease
    109391068 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    109391068 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109391068 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109391068 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109391068 (BAX)
   05152 Tuberculosis
    109391068 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109391068 (BAX)
   05170 Human immunodeficiency virus 1 infection
    109391068 (BAX)
   05162 Measles
    109391068 (BAX)
   05164 Influenza A
    109391068 (BAX)
   05161 Hepatitis B
    109391068 (BAX)
   05160 Hepatitis C
    109391068 (BAX)
   05168 Herpes simplex virus 1 infection
    109391068 (BAX)
   05163 Human cytomegalovirus infection
    109391068 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109391068 (BAX)
   05169 Epstein-Barr virus infection
    109391068 (BAX)
   05165 Human papillomavirus infection
    109391068 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109391068 (BAX)
   01524 Platinum drug resistance
    109391068 (BAX)
   01522 Endocrine resistance
    109391068 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hai03029]
    109391068 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hai02000]
    109391068 (BAX)
Mitochondrial biogenesis [BR:hai03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    109391068 (BAX)
Transporters [BR:hai02000]
 Other transporters
  Pores ion channels [TC:1]
   109391068 (BAX)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 109391068
NCBI-ProteinID: XP_019513823
LinkDB
Position
Un
AA seq 193 aa
MDGSGEQPRDGGPTSSEQIMKTGALLLQGFIQDRAGRIGGEAPDLALEPRLPQDASTKKL
SECLKRIGDELDSNVELQRMIAAVDTDSPREVFYRVASEMFSDGNFNWGRVVALFYFASK
LVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAG
VLTASLTIWKKMG
NT seq 582 nt   +upstreamnt  +downstreamnt
atggacgggtccggggagcaacccagagacggggggcccaccagctctgagcagatcatg
aagacaggggcccttttacttcagggtttcatccaggatcgagcagggcgaatcggggga
gaggcacctgacctggccctggagcccaggttgccccaggatgcatccaccaagaagctg
agcgagtgtctcaagcgcattggagatgaactggacagtaatgttgagctgcagaggatg
atcgcagctgtggacacagactccccccgtgaggtcttttaccgagtggcgtctgagatg
ttttccgatggcaacttcaactggggccgggttgtcgcccttttctactttgccagcaaa
ctggtgctcaaggccctgtgcaccaaagtgcccgagctgataaggaccatcatgggctgg
acactggacttccttcgagagcggctgctgggctggatccaggaccagggtggttgggat
ggcctcctctcctactttgggacacccacgtggcagacagtgaccatctttgtggctgga
gtactcactgcctcactcaccatctggaagaagatgggctaa

DBGET integrated database retrieval system