KEGG   Hipposideros armiger (great roundleaf bat): 109391592Help
Entry
109391592         CDS       T04661                                 

Gene name
LDLR
Definition
(RefSeq) low density lipoprotein receptor
  KO
K12473  low-density lipoprotein receptor
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04144  Endocytosis
hai04913  Ovarian steroidogenesis
hai04925  Aldosterone synthesis and secretion
hai04927  Cortisol synthesis and secretion
hai04934  Cushing syndrome
hai04976  Bile secretion
hai04979  Cholesterol metabolism
hai05145  Toxoplasmosis
hai05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:hai00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109391592 (LDLR)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    109391592 (LDLR)
   04925 Aldosterone synthesis and secretion
    109391592 (LDLR)
   04927 Cortisol synthesis and secretion
    109391592 (LDLR)
  09154 Digestive system
   04976 Bile secretion
    109391592 (LDLR)
   04979 Cholesterol metabolism
    109391592 (LDLR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109391592 (LDLR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    109391592 (LDLR)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109391592 (LDLR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hai04131]
    109391592 (LDLR)
Membrane trafficking [BR:hai04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    109391592 (LDLR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition cEGF EGF_CA SGL EGF hEGF
Motif
Other DBs
NCBI-GeneID: 109391592
NCBI-ProteinID: XP_019514782
LinkDB All DBs
Position
Un
AA seq 773 aa AA seqDB search
MLQMTGAPRAVAAGLREARVSRGHPADRERRTAAWAGALLAGAGSMRLCWSVALLLAAAG
AAVEDKCERNEFQCQDGTCISYKWVCDGSAECKDGSDESQQTCMSVTCKVEDFSCGGRVN
RCIPQFWRCDGQVDCANGSDEQGCPPKTCSQDEFRCHDGKCIAPGFVCDSDWDCLDGSDE
ASCPTPTCGPSSFQCNSSTCIPELWLCDGDPDCHDGSDEWPQHCGGRNTSATQEEKPCSA
LEFHCHSGECIHSSWRCDGGSDCKDKSDEENCAMATCRPDEFQCSDGTCIHGSQQCDREY
DCKDKSDELGCINVTLCEGPNKFKCRSGECITMDKVCNSVRDCRDWSDEPLNECGTNECL
DKKGGCSHVCNDLKIGYECLCPMGYQLADRRKCEDIDECQDPNACSQICVNLEGSFKCEC
ESGFQLDPFTKACKATGTIAYLFFTNRHEVRKMTLDRREYTSLIPNLKNVVALDMEVASN
RIYWSDLSQKKIYSTQVDRAPSFSYDTVIGDDLQAPDGLAVDWIYGNIYWTDSILGTISV
ADTKGVKRKTLFKEKGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDVYSLVTEDI
QWPNGITLDLSSGRLYWVDSKLHSISSIDVNGGNRKTVLEDKKKLAHPFSLAIFEDKVFW
TDIINEAIFSANRLTGSDINLMAENLLSPEDIVLIHNFTQPRGVNWCKRTTLPNGGCQYL
CLPAPQINPHSPKFTCACPDGMLLAKDRRNCLTAPPCSWTFLNLSLLIYQMGE
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaaatgactggagctccgcgtgcagtcgccgctgggctgcgcgaagcccgggtt
tccagggggcaccctgcggaccgcgaacggcgaacagcggcctgggccggggcattgctg
gcgggggctgggagcatgaggctgtgctggtccgttgccctgctcctcgccgcggcgggg
gctgcagtggaagataaatgtgaaagaaatgagttccagtgccaagatgggacatgcatc
tcctacaagtgggtttgcgacgggagcgcagagtgcaaggacggttcggatgagtctcag
cagacgtgcatgtctgtcacctgcaaggtggaggacttcagctgtggtggccgtgtcaac
cgctgcattcctcagttctggaggtgtgatggccaggtggactgtgcgaatggctcagac
gagcaaggctgtccccccaagacttgctcccaggacgagttccgctgccacgacgggaag
tgcatcgcgccggggtttgtctgtgactcggactgggactgtttggacggttctgacgag
gcatcctgccccacgcccacctgcggcccttccagcttccagtgcaatagctccacctgc
atccctgagctgtggctctgcgacggggatcccgactgccatgatggctcagacgagtgg
ccgcagcactgtggtggccgcaacacgtccgccacacaagaggaaaaaccctgctcggcc
ctcgagttccactgccacagcggggaatgcattcactccagctggcgctgcgacgggggc
tctgactgcaaggacaagtctgacgaagagaactgcgctatggccacgtgccggcctgac
gagttccagtgctcagatgggacctgcatccacggcagccagcagtgcgacagggagtat
gactgcaaggacaagagtgatgagcttggatgcatcaatgtgactttgtgcgagggtccc
aacaagttcaagtgccgcagcggtgaatgcatcaccatggacaaagtgtgcaactcggtc
cgggactgccgggactggtcggacgagcccctcaacgaatgtgggaccaacgagtgccta
gacaagaagggcggctgctcccacgtctgcaacgacctcaagattggctacgagtgcttg
tgtcccatgggctaccagctggcagaccggcgaaaatgcgaagatattgacgagtgtcag
gaccccaacgcctgcagccagatctgcgtgaaccttgagggcagtttcaagtgtgagtgt
gagtcgggcttccagctggaccccttcaccaaggcctgcaaggccacaggcaccatcgcc
tacctctttttcaccaaccgccacgaggtgaggaaaatgacgctggaccgcagagaatac
accagcctcatcccaaacttgaagaacgtggtggccctggacatggaggtggccagcaac
agaatctactggtccgacctgtcccaaaagaagatctacagtacccaggttgacagagca
cccagcttctcctatgacacggtcattggtgacgacctccaggcccctgacgggctggcg
gtggactggatctacggcaacatatactggaccgactccatcctgggcaccatctccgtg
gccgacaccaagggcgtgaagagaaagacgctcttcaaggagaaaggctccaagcccagg
gccattgttgtggaccctgtccatggcttcatgtactggacggattgggggactcctgcc
aagatcaagaaggggggcctgaatggtgtggacgtttattcattggtgacagaggacatc
cagtggcccaatggcatcaccctggatctttccagtggccgcctctactgggtcgactcc
aagctccactctatctccagcattgatgtcaatggggggaaccggaagacagttttggag
gacaagaaaaagctggcgcacccattttccttggccatctttgaggataaagtattttgg
acagatatcatcaacgaagccattttcagtgccaaccgcctcacggggtctgacattaac
ttgatggcagaaaacctgttgtcaccagaggacattgtccttattcacaacttcacccag
ccaagaggggtgaactggtgtaagaggaccaccctccccaatggcggctgccagtacctg
tgtctcccagccccacagatcaacccccactcgcccaagttcacttgcgcctgccccgac
ggcatgctgcttgccaaggataggaggaactgcctcacagctccgccctgtagctggacc
ttcctgaacctctctttgctcatctaccaaatgggagagtga

DBGET integrated database retrieval system