KEGG   Hipposideros armiger (great roundleaf bat): 109391654
Entry
109391654         CDS       T04661                                 

Gene name
ICAM1
Definition
(RefSeq) intercellular adhesion molecule 1
  KO
K06490  intercellular adhesion molecule 1
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04064  NF-kappa B signaling pathway
hai04514  Cell adhesion molecules
hai04650  Natural killer cell mediated cytotoxicity
hai04668  TNF signaling pathway
hai04670  Leukocyte transendothelial migration
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai05143  African trypanosomiasis
hai05144  Malaria
hai05150  Staphylococcus aureus infection
hai05164  Influenza A
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05169  Epstein-Barr virus infection
hai05323  Rheumatoid arthritis
hai05416  Viral myocarditis
hai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    109391654 (ICAM1)
   04668 TNF signaling pathway
    109391654 (ICAM1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109391654 (ICAM1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109391654 (ICAM1)
   04670 Leukocyte transendothelial migration
    109391654 (ICAM1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    109391654 (ICAM1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109391654 (ICAM1)
   05416 Viral myocarditis
    109391654 (ICAM1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109391654 (ICAM1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109391654 (ICAM1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109391654 (ICAM1)
   05164 Influenza A
    109391654 (ICAM1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109391654 (ICAM1)
   05169 Epstein-Barr virus infection
    109391654 (ICAM1)
  09174 Infectious disease: parasitic
   05144 Malaria
    109391654 (ICAM1)
   05143 African trypanosomiasis
    109391654 (ICAM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109391654 (ICAM1)
   04090 CD molecules [BR:hai04090]
    109391654 (ICAM1)
   00536 Glycosaminoglycan binding proteins [BR:hai00536]
    109391654 (ICAM1)
   04091 Lectins [BR:hai04091]
    109391654 (ICAM1)
Exosome [BR:hai04147]
 Exosomal proteins
  Proteins found in most exosomes
   109391654 (ICAM1)
CD molecules [BR:hai04090]
 Proteins
  109391654 (ICAM1)
Glycosaminoglycan binding proteins [BR:hai00536]
 Hyaluronan
  Cell surface receptors
   109391654 (ICAM1)
Lectins [BR:hai04091]
 I-type lectins (Siglecs)
  109391654 (ICAM1)
SSDB
Motif
Pfam: ICAM_N Ig_2 Ig_3 AMA-1 C2-set_2 LapA_dom DUF5803
Other DBs
NCBI-GeneID: 109391654
NCBI-ProteinID: XP_019514944
LinkDB
Position
Un
AA seq 529 aa
MASSAARLQLPALLAMLGALLPGPGGAQTSVHLSNDIIPRGGSVQVNCSASCDEDAVLGL
ETQLTKEEVNSGTNWKIYELSDIQKDSRPICFSNCHGIQTSASVSITVYSLPKRVELAPL
PQWQLVGENLTLRCLVEGGVPRRHLSVLLLREEEELSRQPAVGEPAEVTTTVLVDRDNHG
ANFSCRTELDLRPQKQELFQNSSVPRQLRTFVLPMTHPWLVTPRIMEVGTQKLVNCTLHG
LFPASEAQVHLALKDQRLEPKVTYNKDSLSAMAWVKANTEEEGTQQLTCAVILGNQSRTT
RENVTIYSFPAPNLTLSQSEVSEWTMVRVECKAHARAMVTLNGAPPGPPGSSAQFLLNAS
AEDDGRSFLCTAALEVAGKVLHKNKTLELRVLYGPQLEESDCPGNWTWQEGSWETLKCQA
RGNPIPKVNCSRKGDGSVLPIGDRMLVNRNISGTYMCRATSRQVEVTHEVVVNVIYKQND
MVIIIVVAATVILGTVVIAAYLYNRQRKIREYKLQKAREAAALKLNTPP
NT seq 1590 nt   +upstreamnt  +downstreamnt
atggcttcgagcgccgcccgactccagctgcccgcgctcctggccatgctcggggctctg
cttccagggcctggaggtgcccaaacatcagtgcacctctccaacgacatcatacccaga
ggaggctccgtgcaggtgaactgcagtgcctcctgtgacgaagatgctgtcttgggtctg
gagactcagttgactaaagaggaagtgaatagtgggaccaactggaagatctatgaactt
agtgacatacaaaaagacagccgtccaatatgcttctcaaactgtcacggtatccagacg
tcagcttcagtgtccatcactgtgtactcattaccaaagcgtgtggaactggcacccctg
cctcagtggcagttggtaggtgaaaatctcactctgcgctgcctggtggagggaggcgtg
ccccggcgtcacctctctgtgttgctgctccgtgaggaggaagagctgagtcggcagcca
gccgtgggggaacccgctgaggtcacgaccacggtgctggtggacagagacaaccacggc
gccaacttctcttgccgcacggaactggaccttcggccccaaaagcaggaactgttccag
aacagctcagtccccaggcagctccgaaccttcgtcctgccaatgacccacccatggctt
gttactccccggatcatggaagtgggcacacagaagctcgtgaactgcaccctgcacggg
ctgttccctgcctcagaggcccaggtccacctagcgctaaaggaccagaggctggaaccc
aaagtcacgtacaacaaggactctctctcggctatggcctgggtcaaagcgaacacagag
gaagaaggcacccagcagctgacatgtgcagtgattctgggaaaccagagccggacaaca
agggagaatgtgaccatctacagcttccctgctcccaacctgaccctgagccagtctgag
gtctccgagtggactatggtgcgtgtggagtgcaaggcccatgctagagccatggtgacg
ctgaatggagccccacctgggcctccaggctcgagtgcccaattcctgctgaatgccagt
gctgaggacgacgggcgcagcttcttgtgcactgctgccctagaggtggctgggaaggtg
ctgcacaagaacaagaccctggagcttcgtgttttgtatggcccccaactagaagagagt
gattgcccaggaaactggacatggcaggaaggctcctgggagaccctgaagtgccaggcc
agaggaaacccaatccccaaagtgaactgtagccggaaaggggatgggagtgtactgccc
atcggggaccgaatgcttgtcaatcggaacatttcaggcacctacatgtgtcgggccacg
agccgtcaggttgaggtcacccatgaagtggtcgtgaacgtgatctacaagcagaatgac
atggtcatcatcattgtggtggcagctacagtcatcttgggcaccgtggtcatagccgct
tacctctataaccgccagcggaagatccgggaatacaagctacagaaggcccgggaggcg
gctgccctgaagctgaacacgccaccctga

DBGET integrated database retrieval system