KEGG   Hipposideros armiger (great roundleaf bat): 109392135
Entry
109392135         CDS       T04661                                 

Gene name
CREBBP
Definition
(RefSeq) CREB binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04024  cAMP signaling pathway
hai04066  HIF-1 signaling pathway
hai04068  FoxO signaling pathway
hai04110  Cell cycle
hai04310  Wnt signaling pathway
hai04330  Notch signaling pathway
hai04350  TGF-beta signaling pathway
hai04520  Adherens junction
hai04630  JAK-STAT signaling pathway
hai04720  Long-term potentiation
hai04916  Melanogenesis
hai04919  Thyroid hormone signaling pathway
hai04922  Glucagon signaling pathway
hai04935  Growth hormone synthesis, secretion and action
hai05016  Huntington disease
hai05152  Tuberculosis
hai05161  Hepatitis B
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05200  Pathways in cancer
hai05203  Viral carcinogenesis
hai05206  MicroRNAs in cancer
hai05211  Renal cell carcinoma
hai05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109392135 (CREBBP)
   04330 Notch signaling pathway
    109392135 (CREBBP)
   04350 TGF-beta signaling pathway
    109392135 (CREBBP)
   04630 JAK-STAT signaling pathway
    109392135 (CREBBP)
   04066 HIF-1 signaling pathway
    109392135 (CREBBP)
   04068 FoxO signaling pathway
    109392135 (CREBBP)
   04024 cAMP signaling pathway
    109392135 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109392135 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109392135 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    109392135 (CREBBP)
   04935 Growth hormone synthesis, secretion and action
    109392135 (CREBBP)
   04919 Thyroid hormone signaling pathway
    109392135 (CREBBP)
   04916 Melanogenesis
    109392135 (CREBBP)
  09156 Nervous system
   04720 Long-term potentiation
    109392135 (CREBBP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109392135 (CREBBP)
   05206 MicroRNAs in cancer
    109392135 (CREBBP)
   05203 Viral carcinogenesis
    109392135 (CREBBP)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    109392135 (CREBBP)
   05215 Prostate cancer
    109392135 (CREBBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    109392135 (CREBBP)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109392135 (CREBBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109392135 (CREBBP)
   05164 Influenza A
    109392135 (CREBBP)
   05161 Hepatitis B
    109392135 (CREBBP)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109392135 (CREBBP)
   05165 Human papillomavirus infection
    109392135 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hai03000]
    109392135 (CREBBP)
   03036 Chromosome and associated proteins [BR:hai03036]
    109392135 (CREBBP)
   03029 Mitochondrial biogenesis [BR:hai03029]
    109392135 (CREBBP)
Enzymes [BR:hai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     109392135 (CREBBP)
Transcription factors [BR:hai03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    109392135 (CREBBP)
Chromosome and associated proteins [BR:hai03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    109392135 (CREBBP)
Mitochondrial biogenesis [BR:hai03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    109392135 (CREBBP)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 109392135
NCBI-ProteinID: XP_019515875
LinkDB
Position
Un
AA seq 2435 aa
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGELGLLNSGNLVP
DAASKHKQLSELLRGGSGPSINPGIGNVSASSPVQQGLGGQAQGQPNNANMASLGAMGKS
PLNQGDSSAASLPKQAASTSGPTPPASQPLNPQAQKQVGLVTSSPATSQTGPGICMNANF
NQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAMQGATSSVLAE
TLTQVSPQIPSHAGLNTAQAGGMTKMGMTGNTSPFGQPFSQTGGQPMGAPGVNPQLPSKQ
NVVTSLPPFPADIKNASVTNVPNMSQMQTSVGIVPTQAIATGPTADPEKRKLIQQQLVLL
LHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKN
CTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLSNPNPIDPSSM
QRAYAALGLPYLNQPQTQLQPQVPGQQPAQPQTHQQMRTLNPLGNNPMNIPAGGITTDQQ
PPNLISESALPTSLGATNPLMNDGSNSGNIGTLSTIPTAAPPSSTGVRKGWHEHVTQDLR
SHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKI
QKELEEKRRSRLHKQGILGNQPTLPAPGAQPSGIPQPQPVRPPNGPMPLPVNRMQVSQGM
NTFNPISLGNVQLPQAPMGPRAASPMNHSVPMNSMGSVSGMAISPSRMPQPPNMMGAHAN
NMMAQAPAQNQFLAQNQFPSSSGAMSVNSVGMGQPVAQTSVSQGQVPNAALPNPLNMLGP
QTSQLPCPPVTQSPLHQTPPPASTAAGMPSLQHPTAPGMTPPQPAAPTQPSTPVSSSGQT
PTPTPGSVPSASQAQSTPTVQAAAQVTTQPQTPVQPPSVATPQSSQQQPTPVHAQPPGTP
LSQAAASIDNRVPTPSSVASAETSSQQPGPDVPMLEMKTEVKTEDTEPDASEPKGEPGSA
MMEEDLPGSSQVKEESDTTEQKSEPMEVDEKKPEVKVEAKEEEESTANGAASQSASPLQP
RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKR
KLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCC
GRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQT
TISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRTRK
ENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFV
DSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFF
RPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQ
EWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEE
EERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQK
LYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSS
LRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHTH
KMVKWGLGLDDEGGSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKR
VVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQ
QAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVSMSPAG
FPSVARTQPPTTVSTGKPTNQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNINNG
MPPGRTGMVTPVSQMAPVGLNVPRPSQVSGPVMPNLPPGQWQQAPIPQQQPMPGMPRPVM
SMQAQPAVAGPRMPNVQPPRSISPGALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAF
IKQRTAKYVASQPGLQPQPGLQAQPGLQPQPGLHQQPNLQNMNPMQAGGPRPGVPPQQQA
MGGLNPQGQALNIMNPGHNPSMASMNPQYREMLRRQLLQQQQQQQQQQQQGSAGMATGMA
GHGQFQQPQGPGGYPPAMQQQRMQQHLPMQGSSMGQMAAQMGQLGQMGQPGLGADSTPNI
QQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQMATSLSSQVRSPA
PVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHLGNPEQSA
MLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 7308 nt   +upstreamnt  +downstreamnt
atggccgagaacttgctggacggaccgcccaacccgaaaagagccaaactcagctcgccc
ggcttctcggctaatgacagcacagattttggatcattgtttgacttggaaaatgacctt
cctgatgagctgatccccaatggagaattaggccttttaaacagtgggaaccttgttcca
gatgctgcttccaaacataaacaactgtcggagcttctgcgcggaggcagtggccctagc
atcaacccaggaataggaaatgtgagtgccagcagccctgtgcagcaaggcctcggcggc
caggctcaggggcagccgaacaatgcgaacatggccagcctgggtgccatgggcaagagc
cctctaaaccaaggagactcgtcagccgccagcctgcccaagcaggcggccagcacctct
gggcccactccccctgcttcccaaccactgaatccgcaagcacaaaagcaagtgggactg
gtgaccagtagccctgccacgtcgcagacaggacctgggatctgcatgaatgctaacttt
aaccagacccacccaggcctcctcaatagtaactctggccatagtttaatgaaccaggcc
cagcaggggcaggcgcaagtcatgaatggatctctgggggctgctggcagaggaagggga
gctggaatgccgtaccctgctccggccatgcagggggcaacgagcagcgtgctggccgag
acattaacacaggtttcgccgcaaattcccagtcatgcgggactgaacacggcgcaggca
ggaggcatgaccaagatgggaatgactggtaacacgagtccctttggacaaccctttagt
caaactggagggcagccaatgggagcccctggagtgaacccccagttacccagcaaacag
aacgtggtcactagtttgcctcccttccctgcagacatcaagaatgcttctgtcaccaac
gtgccaaacatgtctcagatgcaaacatcggtgggaattgtacccacacaagcaattgca
acgggccccactgcagatcctgaaaaacgcaaactgatacagcagcagctggttctactg
cttcacgctcataaatgtcagagacgagaacaagcaaacggagaggttcgggcctgctct
ctcccacattgtcgaaccatgaaaaatgttttgaatcacatgacacattgtcaggctggg
aaagcctgtcaagttgcccattgtgcatcttcacgacaaatcatctctcattggaagaac
tgcacacgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcgaaac
caacaaaccatcctggggtctccagctagtggaattcagaacaccattggttctgttggt
acaggccagcagaatgccacttctttaagtaaccccaatcccatagaccccagctccatg
cagcgagcatatgctgctctcggactcccatacctgaaccagccccagactcagctgcag
cctcaggttcctggccagcaaccagcacagcctcaaactcaccagcagatgaggactctc
aaccccctgggaaataacccaatgaacattccagcaggaggaataacaacagatcagcag
ccaccaaacttgatttcagaatcagctcttccaacttcccttggagccacaaacccactg
atgaatgacggctccaactctggaaacatcggaaccctcagcactatacctacagcagca
cctccttccagtactggtgttcggaaaggctggcacgaacatgtcactcaggacctgcgg
agccatctagtgcataaactcgtccaagccatcttcccaacacctgaccccgcagccctg
aaggatcgccgcatggagaacctggtggcctatgctaagaaagtggaaggggacatgtac
gagtctgccaacagccgggatgaatactatcacttactagcagagaaaatctacaagata
caaaaagaactagaagaaaaacggaggtcacgtttacacaaacaaggcatcttgggtaat
cagccaaccttaccagcccctggggcgcagccctctgggattccgcagccacaacctgtg
agacctccaaatgggcccatgcccctgcccgtgaaccgcatgcaagtttctcaagggatg
aatacatttaacccgatatctttggggaatgtacagttgccacaggctcccatgggacca
cgtgcagcatctcccatgaaccactctgtcccaatgaacagcatgggctccgtttcaggg
atggccatttctccttcccgaatgcctcagcctccgaacatgatgggtgcacatgccaac
aacatgatggcccaggcgccggcgcagaaccagttcctggcgcagaaccagttcccgtcg
tccagtggggcaatgagcgtgaacagtgtaggcatggggcagccggtggcccagaccagc
gtgtcacaggggcaggtgcctaatgctgctcttcctaaccctctgaacatgcttgggccc
cagaccagccagctgccttgcccaccagtgacgcagtcaccattgcaccagacgccacct
cctgcttccacagccgctggcatgccatctctccagcacccgacggcgcctgggatgact
cctccccagccagcagctcctacccagccatcgactcccgtatcgtcttctgggcagact
cccaccccgactccaggctcagtgcccagtgctagccaagcccagagcacccctacggtc
caggcagcagcccaggtgaccacgcagcctcagaccccagtccagcccccgtccgtggcc
acccctcagtcatcgcagcagcagcccacgcctgtgcatgcccaacctcctggcacgccg
ctttcccaggcagcagccagcattgataacagggtccccactccatcctcggtggccagc
gctgaaaccagctcccagcagccaggacctgatgtaccaatgctggaaatgaagactgag
gtcaagaccgaggacaccgagcctgatgccagtgaacccaaaggggagcctgggtctgcg
atgatggaggaggatctaccaggatcttctcaagttaaagaagaatcagacacaacagag
cagaaatcagaaccaatggaagtggatgaaaagaagccagaagtcaaagtagaagctaaa
gaggaagaagagagcaccgctaatggtgccgcctcccagtcagcgtctcctttgcagcca
cgcaaaaaaatctttaagccggaggagttgcgccaggctcttatgccaaccctagaagcg
ctgtatcgacaagatccagagtccttaccttttcggcagcctgtagatccccagctccta
ggaattccagattattttgacattgtgaagaaccccatggacctctccaccatcaaacgg
aagttggacacagggcagtaccaagaaccctggcagtatgtggacgacgtctggctgatg
ttcaacaacgcctggctctataatcgcaagacgtcccgggtctataagttctgcagtaaa
ctcgcagaggtctttgaacaagaaattgaccctgttatgcagtcccttggatattgctgt
ggacgcaagtatgagttttccccacagactttgtgctgctacgggaagcagctgtgtaca
attcctcgtgatgctgcctactacagctatcagaataggtatcatttctgtgagaagtgt
ttcacagagattcagggggagaatgttaccctgggtgacgacccttcacaaccccagacg
acaatttcaaaggatcaatttgaaaagaagaagaatgataccttagatcctgaacctttt
gttgattgcaaggagtgtggccggaagatgcatcagatttgtgttttacactatgatatc
atttggccttcaggctttgtgtgtgacaactgcttgaagaaaactggcagaactcgaaaa
gaaaacaaattcagtgctaagagactgcagaccacgcgattaggaaaccacttggaagac
cgagtcaacaagtttttgcggcgacagaatcatcctgaagccggggaggtctttgtccga
gtggtggccagctcagacaagactgtggaggtcaagcctgggatgaagtcacggtttgtg
gactctggggaaatgtctgaatctttcccatatcgaaccaaagccctctttgcttttgag
gaaattgatggagtggatgtctgcttttttgggatgcatgtccaagagtatggctctgat
tgcccccctccaaacacaaggcgtgtgtacatatcttatctggacagtattcatttcttt
cggccccgatgccttcggacagccgtttaccatgagatccttattggatatttggaatat
gtgaagaaattagggtatgtgacaggacacatctgggcctgtcccccaagtgaaggagac
gactacatcttccattgccacccccctgatcaaaaaatcccaaaaccgaagcgcctgcag
gagtggtacaagaagatgctggacaaggcgtttgccgaacgcatcatccatgactacaag
gacattttcaaacaagcaactgaagacaggctcaccagtgccaaggaactgccctatttt
gagggtgacttttggcccaatgtgttggaagagagcattaaggagctggaacaagaagaa
gaagagagaaagaaggaagagagtaccgcagccagtgagaccacagagggcagccagggt
gacagcaagaatgccaagaaaaagaacaacaaaaaaaccaacaagaataaaagcagcatc
agccgagccaacaagaagaagcccagcatgcccaacgtgtccaacgacttgtcccagaag
ctctacgccaccatggagaagcacaaagaggtcttctttgtcatccatctgcacgccggg
cccgtcatcaatacgctgccccctatcgtggaccctgaccccctgctcagctgtgacctc
atggatgggcgcgacgccttcctcaccctcgccagggacaagcactgggagttctcctcc
ctgcggcggtccaagtggtccacgctgtgcatgctggtggagctgcatacccagggccag
gaccgctttgtctacacctgcaacgagtgcaagcaccacgtggagacgcgctggcactgc
accgtgtgcgaggactacgacctttgcatcaactgctacaacacaaagagccacacacac
aagatggtgaagtgggggctgggcctggatgacgagggtggcagccagggtgaaccacag
tccaagagcccccaggaatcacggcgcctgagcatccaacgctgcatccagtccctggtg
catgcctgccagtgccgcaacgccaactgctcgctgccgtcctgccagaaaatgaagcgt
gtggtgcagcacaccaagggctgcaagcgcaagaccaatggaggctgcccggtgtgcaag
cagctcatcgccctctgctgctaccatgccaaacactgccaagaaaacaaatgccccgtg
cccttctgcctcaacatcaaacacaagctccgccagcagcagatccagcaccgcctgcag
caggcgcagctcatgcgccggcggatggccaccatgaacacccgcaacgtgcctcagcag
agtctgccttcccctacctcagcaccgccagggacccccacgcagcagcccagcacgccc
cagacaccacagccccctgcccagccccagccctcgcctgtgagcatgtcaccagccggc
ttccccagcgtggcccggactcagccccccaccacggtgtctaccgggaagcccaccaac
caggtgccggccccgccgccccccgcccagcccccacccgcggcagtggaggcggcccgg
cagatcgagcgcgaggcccaacagcagcagcacctgtaccgcgtgaacatcaacaacggc
atgcccccagggcgcacgggcatggtgaccccagtgagccagatggcccctgtcggcctg
aatgtgccccgacccagccaggtcagtgggcctgtcatgcccaacctgccgcctgggcag
tggcagcaggcacccatcccccagcagcagccgatgccaggcatgcccaggcccgtgatg
tccatgcaggcccaaccagctgtggccgggccacggatgcccaacgtgcagccgccccgg
agcatctcgcctggcgccctgcaggacctgctgcggaccctgaagtctcccagctccccg
caacagcaacagcaggtgctcaacatcctcaagtcaaaccctcagctgatggcagctttc
atcaaacagcgcacggccaagtacgtggccagtcagcccggcctacagccccagcccggc
ctccaggcccaacccggcctgcagccccagcctggtctgcaccagcagcctaacctgcag
aacatgaaccccatgcaagccggcgggccacggccaggcgtgcctccccagcagcaggca
atgggaggcctgaacccccagggccaggccctgaacatcatgaacccggggcacaacccc
agcatggcaagtatgaatccgcagtacagagagatgctgcggaggcagctgctgcagcag
caacaacagcagcagcagcaacaacagcagggcagtgcgggcatggccacgggcatggca
gggcacggccagttccagcagcctcaaggacccggaggctaccccccagccatgcagcag
cagcggatgcagcagcacctccccatgcagggcagctccatgggccagatggcggctcag
atggggcagctcggccagatggggcagcccgggctgggcgcagacagcacccccaacatc
cagcaggccctgcagcagcggattctgcagcagcagcagatgaagcagcagattgggtcc
ccaggccagccgaaccccatgagcccccagcagcacatgctctcaggacagccacaggcc
tcgcacctccccggccagcagatggccacgtcccttagtagccaggtgcggtctccggcc
cctgtccaatctccgcggccccagtcccagcctccacattccagcccgtcgccacggata
cagccccagccttcgccacaccatgtctcgccccagactggttccccccacccaggactc
gcagtcaccatggccagctccatagatcagggacacttgggaaaccccgaacagagtgca
atgctcccacagctgaacacccccaacaggagtgcattgtccagtgagctgtccctggtc
ggcgacaccacaggagacaccttagaaaagtttgtggagggtttgtag

KEGG   Hipposideros armiger (great roundleaf bat): 109392262
Entry
109392262         CDS       T04661                                 

Gene name
EP300
Definition
(RefSeq) E1A binding protein p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04024  cAMP signaling pathway
hai04066  HIF-1 signaling pathway
hai04068  FoxO signaling pathway
hai04110  Cell cycle
hai04310  Wnt signaling pathway
hai04330  Notch signaling pathway
hai04350  TGF-beta signaling pathway
hai04520  Adherens junction
hai04630  JAK-STAT signaling pathway
hai04720  Long-term potentiation
hai04916  Melanogenesis
hai04919  Thyroid hormone signaling pathway
hai04922  Glucagon signaling pathway
hai04935  Growth hormone synthesis, secretion and action
hai05016  Huntington disease
hai05152  Tuberculosis
hai05161  Hepatitis B
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05200  Pathways in cancer
hai05203  Viral carcinogenesis
hai05206  MicroRNAs in cancer
hai05211  Renal cell carcinoma
hai05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109392262 (EP300)
   04330 Notch signaling pathway
    109392262 (EP300)
   04350 TGF-beta signaling pathway
    109392262 (EP300)
   04630 JAK-STAT signaling pathway
    109392262 (EP300)
   04066 HIF-1 signaling pathway
    109392262 (EP300)
   04068 FoxO signaling pathway
    109392262 (EP300)
   04024 cAMP signaling pathway
    109392262 (EP300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109392262 (EP300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109392262 (EP300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    109392262 (EP300)
   04935 Growth hormone synthesis, secretion and action
    109392262 (EP300)
   04919 Thyroid hormone signaling pathway
    109392262 (EP300)
   04916 Melanogenesis
    109392262 (EP300)
  09156 Nervous system
   04720 Long-term potentiation
    109392262 (EP300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109392262 (EP300)
   05206 MicroRNAs in cancer
    109392262 (EP300)
   05203 Viral carcinogenesis
    109392262 (EP300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    109392262 (EP300)
   05215 Prostate cancer
    109392262 (EP300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    109392262 (EP300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109392262 (EP300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109392262 (EP300)
   05164 Influenza A
    109392262 (EP300)
   05161 Hepatitis B
    109392262 (EP300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109392262 (EP300)
   05165 Human papillomavirus infection
    109392262 (EP300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hai03000]
    109392262 (EP300)
   03036 Chromosome and associated proteins [BR:hai03036]
    109392262 (EP300)
   03029 Mitochondrial biogenesis [BR:hai03029]
    109392262 (EP300)
Enzymes [BR:hai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     109392262 (EP300)
Transcription factors [BR:hai03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    109392262 (EP300)
Chromosome and associated proteins [BR:hai03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    109392262 (EP300)
Mitochondrial biogenesis [BR:hai03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    109392262 (EP300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 109392262
NCBI-ProteinID: XP_019516128
LinkDB
Position
Un
AA seq 2408 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQGMASQAQQNSPGLGLINS
MVKSPIPNMGMGTSGPNQGPTPSATGMMNSPVNQPAMGMNTGMNAGMNPGMLTAGNGQGM
MPNQVMNGSIGAGRGRPNMQYPNPGMGNAGNLMTEPLQQGSPQMGGQTGLRGPQPLKMGM
MNNPNPYGSPYTQNSGQQIGTSGLGLQIQTKSVLPNSLSPFAMDKKAVPGGGMPNMGQQQ
APQVQQPGLVTPVAPGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNL
PHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQ
QSILTGAPVGLGNASSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQMPTQPQV
QAKSQQNQQSGQSPQGLRTMSSMNASPMGVNGGVGVQTSNLLSDSMLHSAINSQNPMMSE
NASVASLGPMPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRME
NLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQSLLPNAAGMVP
VSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQPGLNQFGQISMPQPPIG
PRQTSPLQHHGQLAQPGTLNPPMGYGPRMQQPSSQSQFLPQTPFSTPGMNVTNMPLAPSG
GQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPPLPQALHQNSPSPVPSRTPTPHHTPP
SIGAQQPPATAIPAPVPTPPAVPPGPQTQTLHPPPRRSPTPPPTQLPPQVQTSLPAAAPA
DQPQQQPLSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSSTEVNSQTI
SEKQPSQEVKMEVKMEVDQPEPADTQPEDMPETKAEDCKVEPTETEERGTELKTETKEEE
DQPSTSVTQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIP
DYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSE
VFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNE
IQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEVIWP
SGFVCDGCLKKTARTRKENKFSAKRLPSTRLGTFLENRVNEFLRRQNHPESGEVTVRVVH
ASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPP
PNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYI
FHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGD
FWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGN
KKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIIDPDPLIPCDLMDGR
DAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCE
DYDLCITCYNTKTHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQ
CRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCL
NIKQKLRQQQLQHRLQQAQMLRRRMASMQRAGVVGQQQGLPSPTPATPTTPTSQQPSTPQ
TPQPQPPSQPQPTPPNSMPPYLPRTQTAGPVSQGKAAGQVTPPTPPQTAQPPLPGPPPAA
VEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMAPMAPMGMNPPPMARGPSGHLEPGMG
PTGMQQQPPWAQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGMSPLKPGT
VSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPLPGQPG
MPQGQPGLQPPAMPGQQGVHSSPAMQNMSPMQPGVQRAGLPQQQPQQQLQPAMGGLSPQA
QQMNMNHSTMPSQFRDILRRQQMMQQQQQQQGAGIGPGLANHNQFQQPQGVGYPQPQPQR
VQHHMQQMQQGNMGQMGQLPQALGAEAGASLQAYQQRLLQQQMGSPAQPNPMSPQQHMLP
SQAQSPHLQGQQIPSSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSS
PHPGLVAAQANPMEQGHFASPDQNSMLSQLTSNPGMANLHGASATDLGLSTDNADLNSNL
SQSTLDIH
NT seq 7227 nt   +upstreamnt  +downstreamnt
atggccgagaatgtggtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtcggccagcgatggcacagattttggctctctgtttgacttggag
catgatttaccagatgaattaatcaactctacagaattgggactaaccaatggtggtgat
attagtcagcttcagacaagtcttggcatagtacaagatgcagcctccaaacataaacaa
ctgtcagaattgctacggtctggtagttccccaaacctcaatatgggggttggtggccca
ggccaaggcatggccagccaggcccaacagaacagtcctgggttaggtttgataaatagc
atggtcaaaagcccaatccccaacatggggatgggcactagtggaccaaatcagggtccc
acgccgtctgcaacaggtatgatgaacagtccagtaaatcagcctgccatgggaatgaac
acagggatgaatgctggcatgaatcctggaatgttgactgcaggcaatggacaggggatg
atgcctaatcaagtcatgaacggttcgattggagcaggccgggggcgaccgaatatgcag
tacccaaacccaggcatgggaaacgctggcaacttaatgactgagccactgcagcagggc
tctccccagatgggcgggcaaacaggattgagaggcccccagcctctcaagatgggaatg
atgaacaaccctaatccttacggttcaccatacactcagaattctgggcagcagattgga
accagtggccttggtctccagatccagacaaagtctgtactaccaaatagcttatctcca
tttgcaatggacaaaaaggcagttcctggtggaggaatgcccaacatgggccagcagcag
gcccctcaggtccagcagccaggcctggtgactccggtagccccagggatgggttctgga
gcgcacacagctgatccagagaagcgcaaactcatccagcagcagcttgttctccttctg
catgctcacaagtgccagcgccgggagcaggccaatggggaagtgaggcagtgcaacctc
ccccactgtcggaccatgaagaatgtcctaaaccacatgacacactgccagtcaggcaag
tcctgccaagtggcacactgtgcatcttctcgacaaatcatttcacactggaagaattgt
acaaggcatgattgtcctgtgtgtctcccccttaaaaatgccggggataagagaaatcaa
cagtcaattctgactggagcaccagttggacttggaaatgctagctctctaggggtgggt
caacagtctacccccagcctaagcactgtcagtcagattgatcccagctctatagaaaga
gcctatgcagctcttggtctaccctatcaagtaaatcagatgccgacacagccccaggta
caagcaaagagccagcagaaccagcagtccgggcagtcaccccaaggcttgcggaccatg
agcagcatgaatgctagtcctatgggagtaaatggaggtgtaggggttcaaacgtcgaat
cttctgtctgactcgatgttgcattcagccataaattctcaaaacccaatgatgagtgaa
aatgccagtgtagcctccctgggtcctatgccaacagcagcgcaaccatccagcactgga
attcggaaacaatggcatgaagacattactcaggatctccgaaatcatcttgttcacaaa
ctagttcaagccatatttcctactccggatcctgctgctttaaaagaccgacggatggaa
aacctagttgcatatgcccggaaagtggaaggggacatgtatgaatctgcaaataatcga
gcggaatactaccacctgctagctgagaagatctataaaatccaaaaagaattagaagaa
aaacgaaggactagactacagaaacaaagcttgctaccaaatgctgcaggcatggtgcca
gtttccatgaatccagggcctaacatggggcagccccaaccaggaatgacttctaatggc
cccctacctgatccatctatgatccgtggcagtgtgccaaaccagatgatgcctcggata
actccacagcctggtttgaatcaatttggccagatcagtatgccgcagccccctattgga
ccccggcaaacctctcctcttcagcaccatggacagttagctcagcctggaactctcaac
cctcctatgggctatgggcctcgcatgcagcagccttccagccagagccaattccttccc
cagactccgttctcaacaccgggaatgaatgtaacgaatatgcctttggctccgtctggc
ggtcaagcaccagtgtctcaagcacaaatgtccagttcttcctgccctgtgaactcgcct
ataatgcctccagggtctcaagggagccacattcactgtcccccactccctcaggctctg
caccagaactcgccctctcctgtacctagtcggacccccaccccccaccacactcccccg
agcataggggctcagcagccaccagcaacagcaattccagcccctgtccctacacctcca
gccgtgccacctgggccgcagacccaaacactgcatccacctccaaggcggtcccctact
cctccaccaacgcaacttcctccgcaagtgcagacttcacttcctgctgctgctcccgcc
gaccagccccagcagcagcctctctcacagcagagcacagcagcatctgttcccacccca
acggcacccctgctgcctccacagcctgcgactccactttcccaaccagctgtaagcatt
gaggggcaggtatcaaaccctccatctactagtagcacagaagtgaattctcagaccatt
tctgagaagcagccttcacaggaagtgaaaatggaggttaaaatggaagtggatcaacca
gaaccagcagatactcagccagaggatatgccagagactaaagcagaagactgtaaagtg
gaacctacagaaacagaagagagaggcactgaattaaagactgaaacaaaagaggaggaa
gaccagccaagtacttcagttacccagtcgtctccagccccaggacagtcaaagaagaaa
attttcaaaccagaagagctacgtcaggcactgatgccaacattggaggcactttaccga
caggatccagaatcccttcccttccgtcaacctgtggaccctcagcttctaggaatccct
gattactttgatattgtgaagagccccatggatctttctaccatcaagaggaagttagac
actggacagtatcaggaaccctggcagtatgtggatgacatttggctgatgttcaacaat
gcctggttatataatcggaaaacatcgcgggtgtacaaatactgctccaagctgtctgag
gtctttgaacaagaaattgacccggtcatgcaaagccttggttattgttgtggcagaaag
ttggagttctctccacagacactctgttgctatggcaaacagttatgtacaatccctcgt
gatgctacttactacagttaccagaacaggtatcatttctgtgagaagtgtttcaatgaa
atccaaggggagagcgtttctttgggggatgacccttcccagcctcaaactacaataaat
aaagaacagttttccaagagaaaaaatgacacactggatcctgaactatttgttgaatgt
acagagtgtggaagaaagatgcatcagatctgtgtacttcatcatgaggtcatctggcca
tctgggtttgtctgtgatggctgtttaaagaaaactgcacgaactaggaaagaaaataag
ttttctgctaaaaggttgccatctaccaggcttggcacctttctggagaatcgggtgaat
gaatttttgaggcgacaaaatcaccccgagtcaggagaggtcactgttcgggtagttcat
gcttctgacaaaaccgtggaagtcaaaccaggcatgaaagcaaggtttgtagatagtgga
gagatggcagaatcctttccatatcgaaccaaagctctctttgcctttgaagaaatcgat
ggtgttgacttatgcttctttggcatgcatgttcaagagtatggctctgactgtccccca
cccaaccagaggagagtatacatatcatacctcgatagtgttcatttcttccgtcctaaa
tgcttgaggactgccgtctatcatgaaattctaattggatatttagaatacgtcaagaaa
ttaggttacacaacagggcatatttgggcatgtcctccaagtgagggcgacgactatatc
ttccattgccaccctcctgaccagaagatacccaagcccaagcgactgcaggagtggtac
aaaaagatgcttgacaaggccgtgtccgagcgaattgtccatgactacaaggatattttt
aaacaagctactgaagatcgattaactagtgcaaaggaattgccttactttgagggtgat
ttctggcccaatgttctggaagagagcattaaggaactggaacaggaggaagaagagagg
aagcgagaggaaaacaccagcaatgaaagcacggatgtaacaaagggagacagcaaaaat
gctaaaaagaagaataataagaaaaccagcaaaaataagagcagcctgagtaggggcaat
aagaagaagccaggcatgcccaatgtatccaatgacctctcacaaaaactgtacgccacc
atggagaaacataaagaggttttctttgtgatccgtctcatcgctggccctgctgccaac
tccctgcctcccatcattgaccctgaccccctcatcccctgcgatctgatggatgggcgg
gatgcctttctcaccctcgcaagggataagcacctggagttctcgtccctccgaagagcc
cagtggtccaccatgtgcatgctagtggagctgcacacccaaagccaggaccgctttgtc
tacacctgcaacgagtgcaagcaccacgtggagacacgctggcactgcaccgtgtgcgag
gattatgatttgtgtatcacctgctataacactaaaacccatgaccacaaaatggagaag
ctggggctcggcttagatgatgagagcaacaaccagcaggctgcggccacccagagcccg
ggagactcccgccgcctgagcatccagcgctgcatccagtccctggtgcacgcctgccag
tgccgcaacgccaactgctcactgccgtcctgccagaagatgaagcgcgtcgtgcagcac
accaagggctgcaaacggaaaaccaatggcggctgccccatctgcaagcagctcatcgcc
ctgtgctgctaccatgccaagcactgccaggagaacaagtgccctgtgcccttctgcctg
aacatcaagcaaaagctccggcagcagcagctgcagcaccggctccagcaggcgcagatg
ctccgcagacggatggccagtatgcagcgggccggcgtggtgggccagcagcaaggccta
ccctccccgaccccagccactccgaccacgccaaccagccagcagcccagcaccccgcag
acgccccagccccagcccccctcccagcctcagcccacccctcccaacagcatgccgccc
tacttgcccaggactcaaactgctggccctgtgtcccagggtaaggcagcaggccaggtg
acccctccaacgccccctcagactgctcagcctccccttccagggcccccacctgcagca
gtggaaatggcaatgcagattcagagggcagcggagacgcagcgccagatggcccacgta
caaatctttcaaaggccaatccagcaccagatgccccagatggctccaatggcccccatg
ggtatgaacccacctcccatggccagaggtcccagcgggcacttggagccagggatgggg
cccaccgggatgcagcaacagccaccgtgggcccaagggggattgcctcagccccagcaa
ctacaatccgggatgccaaggccagccatgatgtcagtggcccagcatggtcagcccttg
aacatggctccccagccaggattgggccaggtaggtatgagccctctgaaaccaggcact
gtgtctcaacaagccttacagaatcttttgcggactctcaggtctcctagctcgcccttg
cagcagcaacaggtgcttagtatccttcacgccaacccccagctgttggctgcattcatc
aagcagcgggctgccaagtacgccaactcgaatccacagcccctccccgggcagccgggc
atgccccagggccagcccgggctgcagccccctgccatgccaggccagcagggggtccac
tccagtcctgcaatgcagaacatgagtcccatgcagccgggcgtccagagggctggcctg
ccccagcagcaaccacagcagcagctccagccggccatgggcggcctgagcccccaggcc
cagcagatgaacatgaaccacagcaccatgccttcacagttccgagacatcttgaggcgc
cagcagatgatgcagcagcagcagcagcagcagggagctgggattggccccgggctggcc
aaccacaaccagtttcagcagccccagggagttggctatccgcaaccacagccccagcgg
gtgcagcatcacatgcagcagatgcaacaagggaacatgggacagatgggccagctcccc
caggccctgggagcagaggcaggagctagtcttcaggcctatcagcagcgactccttcag
cagcaaatggggtcccctgctcagcccaaccccatgagtccccagcagcatatgctccca
agtcaggctcagtccccacacctacaaggccagcagattccttcttctctctccaatcaa
gtgcgttcaccccaacctgtcccttctccacggccgcagtctcaacccccccactccagc
ccttccccaaggatgcagcctcagccttctccacaccacgtctccccacagaccagttct
ccacatccgggactggtagctgcccaggccaaccccatggaacaagggcactttgccagc
ccggaccagaattcgatgctttctcagctcactagcaatccaggcatggcaaacctccat
ggtgcaagcgccacggacctgggactcagcaccgataacgcagacttgaattcaaacctc
tcacagagtacactagacatacactag

DBGET integrated database retrieval system