KEGG   Hipposideros armiger (great roundleaf bat): 109392454
Entry
109392454         CDS       T04661                                 

Gene name
BAK1
Definition
(RefSeq) BCL2 antagonist/killer 1
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01524  Platinum drug resistance
hai04141  Protein processing in endoplasmic reticulum
hai04210  Apoptosis
hai04215  Apoptosis - multiple species
hai05022  Pathways of neurodegeneration - multiple diseases
hai05132  Salmonella infection
hai05160  Hepatitis C
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05202  Transcriptional misregulation in cancer
hai05203  Viral carcinogenesis
hai05206  MicroRNAs in cancer
hai05210  Colorectal cancer
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05214  Glioma
hai05216  Thyroid cancer
hai05217  Basal cell carcinoma
hai05218  Melanoma
hai05220  Chronic myeloid leukemia
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109392454 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109392454 (BAK1)
   04215 Apoptosis - multiple species
    109392454 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109392454 (BAK1)
   05202 Transcriptional misregulation in cancer
    109392454 (BAK1)
   05206 MicroRNAs in cancer
    109392454 (BAK1)
   05203 Viral carcinogenesis
    109392454 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109392454 (BAK1)
   05212 Pancreatic cancer
    109392454 (BAK1)
   05225 Hepatocellular carcinoma
    109392454 (BAK1)
   05226 Gastric cancer
    109392454 (BAK1)
   05214 Glioma
    109392454 (BAK1)
   05216 Thyroid cancer
    109392454 (BAK1)
   05220 Chronic myeloid leukemia
    109392454 (BAK1)
   05217 Basal cell carcinoma
    109392454 (BAK1)
   05218 Melanoma
    109392454 (BAK1)
   05213 Endometrial cancer
    109392454 (BAK1)
   05224 Breast cancer
    109392454 (BAK1)
   05222 Small cell lung cancer
    109392454 (BAK1)
   05223 Non-small cell lung cancer
    109392454 (BAK1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    109392454 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109392454 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109392454 (BAK1)
   05162 Measles
    109392454 (BAK1)
   05164 Influenza A
    109392454 (BAK1)
   05160 Hepatitis C
    109392454 (BAK1)
   05168 Herpes simplex virus 1 infection
    109392454 (BAK1)
   05163 Human cytomegalovirus infection
    109392454 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109392454 (BAK1)
   05169 Epstein-Barr virus infection
    109392454 (BAK1)
   05165 Human papillomavirus infection
    109392454 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109392454 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hai03029]
    109392454 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hai02000]
    109392454 (BAK1)
Mitochondrial biogenesis [BR:hai03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    109392454 (BAK1)
Transporters [BR:hai02000]
 Other transporters
  Pores ion channels [TC:1]
   109392454 (BAK1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 109392454
NCBI-ProteinID: XP_019516480
LinkDB
Position
Un
AA seq 211 aa
MASGQGPGPPRQECEEPASSSTSEEQVAQDTEEVFRSYVFYRHQQEQEADGAAVPADPEI
AAMYLEPASTMAQVGQRLAIIGDDINQRYDEEFQTMLQHLQPTVENAYQYFTKIASSLFE
SGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLHHCIARWIAQRGGWVAA
LDLGNGPIRNVLIVLAVVLLGQYVVRRFFKS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcgtctgggcaaggaccaggccctcccaggcaggagtgtgaagagcctgcttcctcc
tccacttcggaggagcaggtagcccaggacacagaggaagttttccgcagctacgttttt
taccgccatcagcaggagcaggaggctgatggggcggctgtacctgctgacccggaaata
gctgccatgtacctagaacctgccagcaccatggcgcaggtgggacagaggcttgccatc
atcggggacgacatcaaccagcgctatgatgaggagttccagaccatgttgcagcacctg
cagccaacagtagagaatgcctatcagtatttcaccaagatcgcctccagcctgtttgag
agtggcatcaactggggccgagtggtggcgctactgggctttggctaccgcctggcccta
cacgtctaccaacgcggcctgactggcttcctgggccaggtgacccgcttcgtggctgac
ttcatgctgcatcactgcattgcccgatggattgcacagagaggcggctgggtggcagcc
ctggacttgggcaacggccccatccggaacgtgctgatagttttggctgtggttctattg
ggccagtatgtggtacgaagattcttcaagtcatga

DBGET integrated database retrieval system