KEGG   Hipposideros armiger (great roundleaf bat): 109393276
Entry
109393276         CDS       T04661                                 

Gene name
STAT1
Definition
(RefSeq) signal transducer and activator of transcription 1
  KO
K11220  signal transducer and activator of transcription 1
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04062  Chemokine signaling pathway
hai04217  Necroptosis
hai04380  Osteoclast differentiation
hai04620  Toll-like receptor signaling pathway
hai04621  NOD-like receptor signaling pathway
hai04625  C-type lectin receptor signaling pathway
hai04630  JAK-STAT signaling pathway
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04917  Prolactin signaling pathway
hai04919  Thyroid hormone signaling pathway
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai04935  Growth hormone synthesis, secretion and action
hai05140  Leishmaniasis
hai05145  Toxoplasmosis
hai05152  Tuberculosis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05200  Pathways in cancer
hai05212  Pancreatic cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hai05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109393276 (STAT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109393276 (STAT1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109393276 (STAT1)
   04621 NOD-like receptor signaling pathway
    109393276 (STAT1)
   04625 C-type lectin receptor signaling pathway
    109393276 (STAT1)
   04658 Th1 and Th2 cell differentiation
    109393276 (STAT1)
   04659 Th17 cell differentiation
    109393276 (STAT1)
   04062 Chemokine signaling pathway
    109393276 (STAT1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    109393276 (STAT1)
   04935 Growth hormone synthesis, secretion and action
    109393276 (STAT1)
   04919 Thyroid hormone signaling pathway
    109393276 (STAT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109393276 (STAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109393276 (STAT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109393276 (STAT1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109393276 (STAT1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    109393276 (STAT1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109393276 (STAT1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109393276 (STAT1)
  09172 Infectious disease: viral
   05162 Measles
    109393276 (STAT1)
   05164 Influenza A
    109393276 (STAT1)
   05161 Hepatitis B
    109393276 (STAT1)
   05160 Hepatitis C
    109393276 (STAT1)
   05168 Herpes simplex virus 1 infection
    109393276 (STAT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109393276 (STAT1)
   05169 Epstein-Barr virus infection
    109393276 (STAT1)
   05165 Human papillomavirus infection
    109393276 (STAT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109393276 (STAT1)
   05140 Leishmaniasis
    109393276 (STAT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hai03000]
    109393276 (STAT1)
Transcription factors [BR:hai03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    109393276 (STAT1)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind STAT1_TAZ2bind SH2 TRPM_tetra NPV_P10
Other DBs
NCBI-GeneID: 109393276
NCBI-ProteinID: XP_019517889
LinkDB
Position
Un
AA seq 1064 aa
MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQDWEAASNNETMATILLQNL
LIQLDDQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAAN
MPVQGPLEKSLQTSSVSERQRNVEHKVAAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQT
MDQGDKNNTLMSQEVLTLQEMLNSLDFKRKEALSKMTQIVNEMDLLMNSMLIEELQDWKR
RQQIACIGGPLHNGLDQLQNCFTLLAESLFQLKRQLEKLEEQSTKMTYEGDPIPMQRPLL
LERVTFLIYNIFKNSFVVERQPCMPTHPQRPMVLKTLIQFTVKLRVCGQARLHLERHRSD
PAGRAEATGFSRERQHYRAFALPCSTLRAEEHAANDVSFATIRFHDLLSQLDDQYSRFSL
ENNFLLQHNIRKSKRNLQAQSGSIQNTVMLDKQKELDNKVRNVKDKVMSIEHEIKTLEDL
QDEYDFKCKTSQNREHEANGVAKNDQKQEQMLLQKMFLMLDNKRKEVVHKTIELLNVTEL
TQKALINDELVEWKRRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQK
FTYDHDPITKNKQALWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLR
LLVKLQELNYNLKVKVLFDKDVNERSTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRH
LQLKEQKNAGNRTNEGPLVVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPS
GWASILWYNMLVTEARNLSFFLNPPSARWAQLSEVLSWQFSSVTKRGLSVDQLSMLGEKL
LGPNAGPEGLIPWTRFCKENINDKNFSFWLWIESILELIKKHLLSLWNDGCIMGFISKER
ERALLKDQQPGTFLLRFSESCREGAITFTWVERSQNGGEPYFHAVEPYTKKELSAVTFPD
IIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTEL
ISVSEVHPSRLQTTDNLLPMSPEEFDEVSRIVGAVEFDTMMNTV
NT seq 3195 nt   +upstreamnt  +downstreamnt
atgtctcagtggaatcaagtccaacagttagaaatcaaatttttggagcaagtagatcaa
ttctatgatgacaactttcctatggaaattcggcatctgctggcccagtggattgaaaat
caggactgggaggcggcttctaacaatgaaaccatggcaacaattcttcttcaaaacttg
ttaatacaactggatgaccagttaggtcgcgtttcgaaagagaaaaacctactcttgata
cacaatctgaaaagaataaggaaagtccttcagggaaaatttcatggaaatccaatgcat
gtagctgtggttatttcaaattgtttaagagaagagaggagaatattggctgcagccaac
atgcccgttcagggacctctggagaaatccttacaaacttcttcagtttcggaaagacag
aggaatgtggagcacaaagtggctgccattaaaaatagtgtgcagatgacagaacaagac
accaaatatttagaagacctgcaagatgaatttgactacagatataaaacaattcagacg
atggatcaaggtgacaagaacaacaccctaatgagtcaggaagttttgactctgcaagaa
atgctcaacagcctggacttcaagagaaaggaagccctcagtaagatgacacaaatagta
aatgaaatggacctgttaatgaacagcatgctaatagaagaactgcaggactggaagagg
cggcaacaaattgcctgcatcggaggtccacttcataacgggctcgaccagcttcaaaac
tgctttacactgttggcagaaagtctgttccaactcaaaaggcaattggagaaattagag
gagcaatctaccaaaatgacttatgaaggtgatcccatcccgatgcaaagaccacttctg
ctggaaagagtcaccttcttgatctacaacatctttaagaactcatttgtggtcgaacga
cagccatgcatgccaacccaccctcagaggccgatggtacttaaaactctcattcagttc
actgtaaagctaagagtctgcggacaggctcggctgcacttggaacgacacaggtcagac
cccgcaggcagagcagaggccactgggttctcccgagagaggcagcactaccgcgccttc
gcccttccctgctcgacccttcgcgcagaggagcatgccgccaacgatgtttcatttgcc
accatccgttttcatgacctcctgtcgcagctggatgatcaatacagtcgcttttctttg
gagaataattttttgttgcagcataacataaggaaaagcaagcgtaatcttcaggctcag
tcggggagtattcagaacactgtgatgttagataaacagaaggagcttgacaacaaggtc
agaaatgtgaaggacaaagttatgagtatagagcatgaaatcaagaccctagaagattta
caggatgaatatgactttaaatgtaaaacctcgcagaacagagaacatgaagccaatggt
gtggcaaagaatgatcagaaacaggaacagatgttactccagaagatgtttttaatgctt
gacaataagagaaaggaagtagtccacaaaacaatagagttgttgaatgtcaccgaactt
acccagaaagccctgattaatgatgaactggtggaatggaagcgcagacagcagagcgcc
tgtattgggggaccccccaacgcttgcctcgatcagctgcagaactggttcaccatagtt
gcagagagcctacagcaggttcgtcagcagcttaaaaagcttgaggaattggaacagaaa
ttcacctatgatcatgaccccatcacgaaaaacaaacaagccttatgggaccgcactttc
agcctcttccagcagctcattcagagctcattcgtggtggaaagacagccttgcatgcca
actcatcctcagaggccactggtcttgaagactggcgtacaattcactgtgaagctgaga
ctattggtgaaattgcaagagctgaattataacttgaaagtcaaagtcttatttgataaa
gatgtgaatgagagaagtacagtaaaaggattcagaaagttcaacattttgggcacacat
acaaaagtgatgaacatggaggagtccaccaatggaagtctggcagcagaatttcgacac
ctgcaactgaaggaacagaaaaatgctggcaacagaactaacgagggccctcttgtcgtt
actgaagagcttcactcccttagttttgaaacccagttgtgccagcctggtttggtcatt
gaccttgagacgacttctctgcctgtcgtggtgatctccaatgtcagtcagctcccaagt
ggttgggcctccatcctgtggtacaacatgctggtgacagaagccaggaatctgtccttc
ttcctgaacccaccatctgcacgatgggctcagctttcagaggtgctaagttggcagttt
tcttcggtcaccaaaagaggtctcagtgtggaccaactgagcatgctgggagagaaactt
cttggtcctaatgctggccccgaaggtcttattccatggacgcggttctgtaaggaaaat
ataaatgataaaaatttttctttctggctttggatcgaaagcatccttgaactcattaaa
aaacacctgctctctctctggaatgatgggtgtatcatgggcttcatcagcaaggaacgt
gaacgcgccctgttaaaggaccagcagcctgggacgttcctgctgcggttcagtgagagc
tgccgggaaggcgccatcacgttcacgtgggtggagcgctcccagaacggaggcgaacct
tacttccatgcggttgaaccctacacaaagaaagagctttctgctgttactttcccggat
attattcgcaattacaaagtcatggctgctgaaaatattccagagaatcccctgaagtat
ctgtatccaaatattgataaagaccatgcctttggaaagtattactccaggccaaaggaa
gcaccagaaccgatggaacttgatggccctaaaggaaccggatacatcaagactgagttg
atttctgtgtctgaagtccacccttctcgacttcagaccacagacaaccttctccccatg
tctcctgaggagtttgatgaggtgtctcggatagtgggcgctgtagaattcgatactatg
atgaacacagtatag

DBGET integrated database retrieval system