KEGG   Hipposideros armiger (great roundleaf bat): 109393705
Entry
109393705         CDS       T04661                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04010  MAPK signaling pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04390  Hippo signaling pathway
hai04810  Regulation of actin cytoskeleton
hai05200  Pathways in cancer
hai05218  Melanoma
hai05224  Breast cancer
hai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109393705 (FGF1)
   04014 Ras signaling pathway
    109393705 (FGF1)
   04015 Rap1 signaling pathway
    109393705 (FGF1)
   04390 Hippo signaling pathway
    109393705 (FGF1)
   04151 PI3K-Akt signaling pathway
    109393705 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109393705 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109393705 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    109393705 (FGF1)
   05218 Melanoma
    109393705 (FGF1)
   05224 Breast cancer
    109393705 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hai04052]
    109393705 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:hai00536]
    109393705 (FGF1)
Cytokines and growth factors [BR:hai04052]
 Growth factors
  Growth factors (RTK binding)
   109393705 (FGF1)
Glycosaminoglycan binding proteins [BR:hai00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   109393705 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 109393705
NCBI-ProteinID: XP_019518747
LinkDB
Position
Un
AA seq 155 aa
MAEGEIFTFTALTEKFNLPTGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDKSDQHIQLQ
LSAESVGEVYIKSTESGQYLAMDSDGLLYGSQTPSEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPISSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggaaatcttcacgttcacagccctgactgagaagtttaatctgcctaca
gggaattacaagaagcccaaacttctctactgcagcaacgggggccatttcctgaggatc
cttcccgatggcacagtggacgggacaagggacaagagcgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagagcaccgagagtggccagtacttg
gccatggactccgacgggcttttgtacggctcacagacaccaagtgaggaatgtttgttc
ctggaaaggctggaggaaaaccattacaacacctacacgtccaagaagcacgcagaaaag
aattggttcgttgggctcaagaagaacggaagctgcaagcgcggtcctcggactcactac
ggccagaaagcaatcctgtttctccccctgccaatctcctctgattaa

DBGET integrated database retrieval system