KEGG   Hipposideros armiger (great roundleaf bat): 109394017Help
Entry
109394017         CDS       T04661                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04068  FoxO signaling pathway
hai04146  Peroxisome
hai04211  Longevity regulating pathway
hai04213  Longevity regulating pathway - multiple species
hai05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109394017 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109394017 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    109394017 (SOD2)
   04213 Longevity regulating pathway - multiple species
    109394017 (SOD2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    109394017 (SOD2)
Enzymes [BR:hai01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     109394017 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 109394017
NCBI-ProteinID: XP_019519329
LinkDB All DBs
Position
Un
AA seq 222 aa AA seqDB search
MLCRAASSTSRKLVPALGSLGSRQKHTLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNATEDKYQEALEKGDVTTQITLQAALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEV
IKRDFGSFTKFKEKLTAVSAGVQGSGWGWLGFNKEQGRLQIVACPNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYVACKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgccgggcggcgagcagcacgagccggaagctggtgccggcgttggggtctctg
ggctccaggcagaagcacaccctccccgacttgccatacgactatggcgccctggagcca
cacatcaacgcccagatcatgcagctgcaccacagcaagcaccacgcggcctatgtgaac
aacctgaatgccaccgaggacaagtaccaggaggcgctggagaagggtgatgttacaact
cagataactcttcaggctgcactaaagttcaacggtggaggccatatcaatcatagcatt
ttctggacaaacctgagccctaatggcggtggagaacccaaaggggaattgctggaagtc
atcaaacgtgactttggttccttcaccaaatttaaggagaagctgaccgctgtatctgct
ggtgttcaaggttcaggttggggttggcttggtttcaataaggagcagggacgcttacag
attgttgcttgtcctaaccaggatcccctgcagggaacaacaggtttgattccactgctg
ggaattgatgtgtgggagcatgcttattaccttcagtacaaaaatgtcagacctgattat
ctaaaagcgatttggaacgtaatcaactgggagaatgtaactgaaagatacgtggcttgc
aaaaagtaa

DBGET integrated database retrieval system