KEGG   Hipposideros armiger (great roundleaf bat): 109394075
Entry
109394075         CDS       T04661                                 

Gene name
DNAJC3
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member C3
  KO
K09523  DnaJ homolog subfamily C member 3
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04141  Protein processing in endoplasmic reticulum
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109394075 (DNAJC3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    109394075 (DNAJC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hai03110]
    109394075 (DNAJC3)
Chaperones and folding catalysts [BR:hai03110]
 Heat shock proteins
  HSP40 / DNAJ
   109394075 (DNAJC3)
SSDB
Motif
Pfam: TPR_1 TPR_2 TPR_19 DnaJ TPR_16 TPR_8 TPR_14 TPR_11 TPR_9 TPR_17 TPR_12 ANAPC3 TPR_20 TPR_21 TPR_6 PRAI ChAPs TPR_10 Ndufs5
Other DBs
NCBI-GeneID: 109394075
NCBI-ProteinID: XP_019519397
LinkDB
Position
Un
AA seq 504 aa
MVTPSSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQF
HAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIELKMDFTAARLQRGHLLLKQGK
LDEAEDDFKKVLKSNPSENEEKEAQSQLTKSDEMQRLRSQALDAFESSDYAAAITFLDKI
LEVCVWDAELRELRAECFIKEGEPRKAISDLKAASKLKNDNTEAFYKISTLYYQLGDHEL
SLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTDATSKYESVMKTEPS
VSEYVIRSKERICHCFSKDEKPVEAIRVCSEVLQMEPDNVNALKDRAEAYLIEEMYDEAI
QDYETAQEHNENDQQIREGLEKAQRLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLALQ
WHPDNFQNEEEKKKAEKKFIDIAAAKEVLSDPEMRKKFDDGEDPLDAESQQGGGGSPFHR
SWNSWQGFNPFSSGGPFRFKFHFN
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggtgacccccagctctgtgaccagccgactgggctcggtgttccccttcttgctggtc
ctggtcgacctgcagtacgaaggtgctgaatgtggagtaaatgcagatgttgagaaacat
cttgaattgggcaagaaattacttgcagctggacagctagcagatgctttatcgcagttt
catgctgcagtagatggtgacccagataactatattgcttactatcggagagctactgtc
tttttagctatgggcaaatcaaaggcagcacttcctgatttaactaaagtgattgaattg
aagatggatttcactgcagcaagattacagagaggtcacttattactcaaacaaggaaaa
ctcgatgaagcggaagatgattttaaaaaagtgctcaaatccaatccaagtgaaaatgaa
gaaaaggaagcccagtcccaacttacaaaatctgatgaaatgcagcgtttgcgttcacaa
gcacttgatgcttttgaaagttcggattatgcagctgctataaccttccttgataagatt
ttagaggtttgtgtttgggatgcagaactacgggaacttcgagctgaatgttttataaaa
gaaggggaacctaggaaagcgataagtgacttaaaagctgcatcaaaattgaagaatgat
aatactgaggctttttataagatcagcacactgtactatcagctaggagaccatgaactg
tccctcagtgaagttcgtgaatgtcttaaacttgaccaggatcataaaaggtgttttgca
cactataaacaagtaaagaaacttaataagcttattgagtcagctgaagagctcatcaga
gatggcagatacacagatgcgaccagcaaatatgagtctgtcatgaaaacagagccaagt
gtttccgaatatgtaattcgttcaaaagagaggatttgccactgcttttctaaggatgag
aagcctgttgaagcgattcgagtgtgttctgaagttttacagatggaacctgacaacgtg
aatgctctgaaagatcgagcagaggcctatttaatagaagaaatgtatgatgaagctatt
caggattatgaaactgctcaggaacacaatgaaaacgatcagcagattcgggaaggtcta
gagaaagcacagagactattgaaacagtcgcagaaacgagattattataaaatcttggga
gtaaaaagaaatgccaaaaagcaagaaatcattaaagcatatagaaaattagcactacag
tggcacccagataacttccagaatgaagaagaaaagaagaaagctgagaaaaaattcatt
gatatagcagctgctaaagaagtcctctctgatccagaaatgaggaagaagtttgatgac
ggagaagatccgctggatgcagagagccaacaaggtggtggcggcagccctttccacaga
agctggaactcatggcaagggttcaatcctttcagctcaggaggaccttttagatttaaa
ttccacttcaattaa

DBGET integrated database retrieval system