KEGG   Hipposideros armiger (great roundleaf bat): 109394265
Entry
109394265         CDS       T04661                                 

Gene name
DNAJB1
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member B1
  KO
K09507  DnaJ homolog subfamily B member 1
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04141  Protein processing in endoplasmic reticulum
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109394265 (DNAJB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    109394265 (DNAJB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hai03110]
    109394265 (DNAJB1)
Chaperones and folding catalysts [BR:hai03110]
 Heat shock proteins
  HSP40 / DNAJ
   109394265 (DNAJB1)
SSDB
Motif
Pfam: DnaJ_C DnaJ
Other DBs
NCBI-GeneID: 109394265
NCBI-ProteinID: XP_019519729
LinkDB
Position
Un
AA seq 340 aa
MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRK
REIFDRYGEEGLKGSGPSGGSSGGANGTSFSYTFHGDPHAMFAEIFGGRNPFDTFFGQRN
GEEGMDVDDPFTGFPMGMGGFTNMNFGRSRPVQELTRKKQDPPVTHDLRVSLEEIYSGCT
KKMKISHKRLNPDGKSIRNEDKILTIEVKRGWKEGTKITFPKEGDQTSNNIPADIVFVLK
DKPHNIFKRDGSDVIYPARITLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGE
GLPLPKTPEKRGDLIIEFEVIFPERIPQASRTKLEQALPI
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgggcaaagactattaccagacgctgggcctagcccgcggcgcgtcagacgaggagatc
aagcgggcctaccgccgccaggcgctgcgctaccacccagacaagaacaaggagcccggc
gccgaggagaagttcaaggagatcgccgaggcctacgatgtgctcagcgacccgcgcaag
cgcgagatcttcgaccgctacggggaggaaggcctaaagggcagtggccccagtggtggg
agcagcggtggtgctaatggtacctccttcagctacacattccatggagaccctcatgcc
atgtttgctgagatcttcggtggccgaaatccctttgacaccttttttgggcagcggaac
ggggaggaaggcatggacgttgatgacccgtttactggcttccccatgggcatgggcggc
tttacaaacatgaactttggccggtctcgccctgtgcaagagctcacccggaaaaagcaa
gacccccctgtcacccatgaccttagggtttcccttgaagagatctacagcggctgcacc
aagaagatgaagatctcccataaacggctgaacccagacgggaagagcattcgcaatgaa
gataaaattctgaccattgaagtaaaacggggttggaaagaagggaccaaaatcaccttc
cccaaggagggagaccagacctccaacaacattccagctgacatcgtctttgttttaaag
gacaagccacacaatatctttaagagagatggctctgatgtcatttacccagccaggatc
acccttcgggaggctctgtgtggctgtactgtgaacgtccccactctggatggcaggacc
atacccgtcgtgttcaaagatgtcatcaggccaggcatgaggcgaaaagttcctggagaa
ggcctccccctccccaaaacgcccgagaaacgtggggacctcattattgaatttgaagtg
atcttccctgaaaggattccccaggcatcaagaaccaaacttgaacaggcccttccgata
tag

DBGET integrated database retrieval system