KEGG   Hipposideros armiger (great roundleaf bat): 109394441
Entry
109394441         CDS       T04661                                 

Gene name
TGFBR2
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04010  MAPK signaling pathway
hai04060  Cytokine-cytokine receptor interaction
hai04068  FoxO signaling pathway
hai04144  Endocytosis
hai04218  Cellular senescence
hai04350  TGF-beta signaling pathway
hai04380  Osteoclast differentiation
hai04390  Hippo signaling pathway
hai04520  Adherens junction
hai04659  Th17 cell differentiation
hai04926  Relaxin signaling pathway
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai05142  Chagas disease
hai05161  Hepatitis B
hai05166  Human T-cell leukemia virus 1 infection
hai05200  Pathways in cancer
hai05202  Transcriptional misregulation in cancer
hai05210  Colorectal cancer
hai05212  Pancreatic cancer
hai05220  Chronic myeloid leukemia
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109394441 (TGFBR2)
   04350 TGF-beta signaling pathway
    109394441 (TGFBR2)
   04390 Hippo signaling pathway
    109394441 (TGFBR2)
   04068 FoxO signaling pathway
    109394441 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109394441 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109394441 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    109394441 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109394441 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    109394441 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    109394441 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109394441 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109394441 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    109394441 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109394441 (TGFBR2)
   05212 Pancreatic cancer
    109394441 (TGFBR2)
   05225 Hepatocellular carcinoma
    109394441 (TGFBR2)
   05226 Gastric cancer
    109394441 (TGFBR2)
   05220 Chronic myeloid leukemia
    109394441 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109394441 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109394441 (TGFBR2)
   05161 Hepatitis B
    109394441 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109394441 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109394441 (TGFBR2)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     109394441 (TGFBR2)
Protein kinases [BR:hai01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   109394441 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 109394441
NCBI-ProteinID: XP_019520060
LinkDB
Position
Un
AA seq 567 aa
MGRGLLRGLWPLHIFLWTRIASTIPPHVQKSVNNNMMVTDNNGAVKFPQLCKFCDVRSST
CDNQKSCMSNCSITSICENPHEVCVAVWRKNDENITLETVCHDPKLVYHGFVLEDAASPK
CIMKEKKVNGETFFMCSCSTDECNDIIIFSEEYSPNNPDLLLVIFQVTGISLLPPLGIAI
AVIITFYCYRVHRKQKLTPSWETSKPRKLMEFSEQLAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKMEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAH
LHSDHTLCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSSWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSE
LEHLDRLSGRSCSEEKIPEDGSLSTTK
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgggtcgggggctgctcaggggcctgtggccgctgcacatcttcctgtggacgcgcatc
gccagcacgatcccaccgcacgttcagaagtcggttaataataacatgatggtcactgac
aacaatggtgcagtcaagtttccacaattgtgtaaattttgtgatgtgaggtcttccacc
tgtgacaaccagaaatcctgcatgagcaactgcagcatcacgtccatctgtgagaaccca
cacgaagtctgtgtggctgtctggagaaagaatgatgagaacatcacgctggagaccgtt
tgccacgaccccaagctcgtctaccatggatttgtccttgaagatgctgcttcgccaaag
tgtatcatgaaggaaaagaaagtgaatggcgagactttctttatgtgttcctgcagcacg
gatgagtgcaatgacatcatcatcttctcagaagaatattcccccaacaaccctgacttg
ctgttagtcatattccaagtgacgggcatcagcctgctgccaccactgggcattgccata
gccgtcatcatcaccttctactgctaccgtgttcaccggaagcagaagctgactccgtcc
tgggagaccagcaagccccggaagctcatggagttcagcgagcagcttgccatcattcta
gaagatgaccgctcggacatcagctctacgtgtgccaacaacatcaaccacaacacggag
ctgctgcccatcgagctggacaccctggtggggaaaggtcgcttcgctgaggtctacaag
gccaagctgaaacagaacacatcagaacagtttgagaccgtggcggttaagatcttccct
tatgaggagtatgcctcctggaagatggagaaggacattttctcggacatcaacctgaaa
cacgagaacatcctccagttcctgacggccgaggagcggaagacggagttggggaagcag
tattggctgatcaccgctttccatgccaagggaaacctacaggaatacctcacgcggcat
gtcatcagctgggaggacctccgcaagctgggcagctccctcgcccggggcattgcccac
ctgcacagtgaccacaccctgtgcgggaggcccaagatgcccatcgtgcacagggacctc
aagagctccaatatccttgtgaagaatgacttgacctgctgcctgtgtgactttgggctt
tccctgcgcctggacccgactctgtctgtggatgacttggccaacagcgggcaggtggga
actgcaagatacatggccccagaagtgctcgagtccaggatgaatttggagaatgttgag
tccttcaagcagacagatgtctactccatggctctggtgctctgggaaatgacgtcacgc
tgcaatgcagtaggagaagtgaaagattatgagccgccatttggttccaaggtgcgggag
cacccctgtgtcgaaagcatgaaggacaatgtgttgagagatcggggacgacctgaaatt
cccagctcctggctcaaccaccagggcatccagatggtgtgtgagactctgaccgaatgc
tgggaccatgaccctgaagcccggctcacggcccagtgtgtggcagagcgcttcagtgag
ctggagcacctggatagactctcggggaggagctgctcggaggagaagattcccgaagac
ggctcgctaagcactaccaaatag

DBGET integrated database retrieval system