KEGG   Hipposideros armiger (great roundleaf bat): 109394554
Entry
109394554         CDS       T04661                                 

Gene name
IL33
Definition
(RefSeq) interleukin 33
  KO
K12967  interleukin 33
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04060  Cytokine-cytokine receptor interaction
hai04217  Necroptosis
hai04623  Cytosolic DNA-sensing pathway
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109394554 (IL33)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109394554 (IL33)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    109394554 (IL33)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    109394554 (IL33)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hai04052]
    109394554 (IL33)
Cytokines and growth factors [BR:hai04052]
 Cytokines
  Interleukins
   109394554 (IL33)
SSDB
Motif
Pfam: IL33
Other DBs
NCBI-GeneID: 109394554
NCBI-ProteinID: XP_019520255
LinkDB
Position
Un
AA seq 271 aa
MKPEMKYSTTKISSAKMSSSSGKALVKSPRLRKPLQKAKEVCQMYFMQLRSGLIIKKACY
FRKETTNGHSRKTAGKYKEQRLFLSDSPRFLNKSVDFTFDVPMVRKCTRANDGSSSIQEC
SVSLSTYNDQSITFLFVDGGYEISVEDLGNNQKKDKVLFRYYDSQITTSETGDGVDGQIV
MVSLSPTNDKDVLLHANNKEHSVELQKCETPFPDQTFFLLHKEPSSSKWVSFECKSNPGV
FIGVKDNQLALIKLGDQTEGSSRESIIFKLS
NT seq 816 nt   +upstreamnt  +downstreamnt
atgaagcctgaaatgaaatattcaaccaccaaaatttcctcagcaaagatgagcagctcc
tcaggcaaagccctggtaaaatctcccaggttgagaaaacccctacagaaggccaaagaa
gtttgccagatgtactttatgcagctacgctctggcctcatcataaaaaaggcctgttat
tttaggaaagaaaccaccaacgggcattcacgaaaaacagctggaaagtacaaggagcaa
cgtttgtttttgtctgacagtccgaggttcctgaataagtctgtagacttcacctttgat
gtacctatggtcaggaaatgtactagagcaaatgatggttcttcaagtatccaagaatgt
tctgtttccttgagcacatacaatgatcaatccattacttttctttttgtggatggaggt
tatgagatctctgttgaagatttgggaaataaccaaaaaaaagacaaggtgttattccgt
tactatgattcgcaaatcaccacaagtgaaacaggtgatggtgttgatggtcagatagta
atggtaagcctgagtcctacaaatgacaaagatgtcttgctgcatgccaacaacaaggag
cactctgtggagctacaaaaatgtgaaaccccgtttccagaccagaccttctttctcctt
cacaaggagccctcatcctccaaatgggtttcatttgaatgtaagagcaatcctggagtg
tttataggagtaaaggataaccaacttgctctaattaaattaggggaccaaactgagggt
tcaagtagagagagtatcatatttaagctctcttaa

DBGET integrated database retrieval system