KEGG   Hipposideros armiger (great roundleaf bat): 109394672
Entry
109394672         CDS       T04661                                 

Gene name
TP53
Definition
(RefSeq) tumor protein p53
  KO
K04451  tumor protein p53
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01522  Endocrine resistance
hai01524  Platinum drug resistance
hai04010  MAPK signaling pathway
hai04071  Sphingolipid signaling pathway
hai04110  Cell cycle
hai04115  p53 signaling pathway
hai04137  Mitophagy - animal
hai04151  PI3K-Akt signaling pathway
hai04210  Apoptosis
hai04211  Longevity regulating pathway
hai04216  Ferroptosis
hai04218  Cellular senescence
hai04310  Wnt signaling pathway
hai04722  Neurotrophin signaling pathway
hai04919  Thyroid hormone signaling pathway
hai05012  Parkinson disease
hai05014  Amyotrophic lateral sclerosis
hai05016  Huntington disease
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05200  Pathways in cancer
hai05202  Transcriptional misregulation in cancer
hai05203  Viral carcinogenesis
hai05205  Proteoglycans in cancer
hai05206  MicroRNAs in cancer
hai05210  Colorectal cancer
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05216  Thyroid cancer
hai05217  Basal cell carcinoma
hai05218  Melanoma
hai05219  Bladder cancer
hai05220  Chronic myeloid leukemia
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
hai05230  Central carbon metabolism in cancer
hai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109394672 (TP53)
   04310 Wnt signaling pathway
    109394672 (TP53)
   04071 Sphingolipid signaling pathway
    109394672 (TP53)
   04151 PI3K-Akt signaling pathway
    109394672 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    109394672 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    109394672 (TP53)
   04210 Apoptosis
    109394672 (TP53)
   04216 Ferroptosis
    109394672 (TP53)
   04115 p53 signaling pathway
    109394672 (TP53)
   04218 Cellular senescence
    109394672 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    109394672 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109394672 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    109394672 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109394672 (TP53)
   05202 Transcriptional misregulation in cancer
    109394672 (TP53)
   05206 MicroRNAs in cancer
    109394672 (TP53)
   05205 Proteoglycans in cancer
    109394672 (TP53)
   05203 Viral carcinogenesis
    109394672 (TP53)
   05230 Central carbon metabolism in cancer
    109394672 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109394672 (TP53)
   05212 Pancreatic cancer
    109394672 (TP53)
   05225 Hepatocellular carcinoma
    109394672 (TP53)
   05226 Gastric cancer
    109394672 (TP53)
   05214 Glioma
    109394672 (TP53)
   05216 Thyroid cancer
    109394672 (TP53)
   05220 Chronic myeloid leukemia
    109394672 (TP53)
   05217 Basal cell carcinoma
    109394672 (TP53)
   05218 Melanoma
    109394672 (TP53)
   05219 Bladder cancer
    109394672 (TP53)
   05215 Prostate cancer
    109394672 (TP53)
   05213 Endometrial cancer
    109394672 (TP53)
   05224 Breast cancer
    109394672 (TP53)
   05222 Small cell lung cancer
    109394672 (TP53)
   05223 Non-small cell lung cancer
    109394672 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    109394672 (TP53)
   05014 Amyotrophic lateral sclerosis
    109394672 (TP53)
   05016 Huntington disease
    109394672 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109394672 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109394672 (TP53)
   05161 Hepatitis B
    109394672 (TP53)
   05160 Hepatitis C
    109394672 (TP53)
   05162 Measles
    109394672 (TP53)
   05168 Herpes simplex virus 1 infection
    109394672 (TP53)
   05163 Human cytomegalovirus infection
    109394672 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109394672 (TP53)
   05169 Epstein-Barr virus infection
    109394672 (TP53)
   05165 Human papillomavirus infection
    109394672 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109394672 (TP53)
   01522 Endocrine resistance
    109394672 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hai03000]
    109394672 (TP53)
   03036 Chromosome and associated proteins [BR:hai03036]
    109394672 (TP53)
   03400 DNA repair and recombination proteins [BR:hai03400]
    109394672 (TP53)
Transcription factors [BR:hai03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    109394672 (TP53)
Chromosome and associated proteins [BR:hai03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109394672 (TP53)
DNA repair and recombination proteins [BR:hai03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    109394672 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD DEC-1_N
Other DBs
NCBI-GeneID: 109394672
NCBI-ProteinID: XP_019520506
LinkDB
Position
Un
AA seq 388 aa
MEVPQSELNMESPLSQETFSDYWKLLPDDNVLSPDISLTVDELLLSPDLVNWVDEGANEA
ASMPATPAPAAATPAPTTSPAPANSWPLSSFVPSQKTYPGNYGFQLGFLNSGTAKSVTCT
YSPTLNKLFCQLAKTCPVQLWVSSPPPLGTRVRAMAIYKKSEYMTEVVRRCPHHERCSDN
SDGLAPPQHLIRVEGNLRAEYLDDKNTFRHSVVVPYEPPEVGSDCTTIHYNFMCNSSCMG
GMNRRPILTIITLEDSSGTLLGRNSFEVRICACPGRDRRTEEENFRKKGEPCPKQPPGSS
KRALPNNTSSSPPPKVPRDGEYFTLQIRGRERFEMFQELNEALELKDAQAGKESGGSRAH
SSHLKSKKGQSTSRHKKLMLKREGLDSD
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggaggtaccacagtcagaactcaatatggagtcccctctaagtcaggagacattttca
gactattggaaactacttcctgatgacaatgttctgtcccctgacatatccctaacagtg
gatgaactgctgctgtccccagaccttgtgaactgggtggacgaaggtgcaaatgaagcc
gccagtatgccagcaactcctgcacctgcagctgccacccctgcaccaaccacctcccct
gcaccagccaattcctggcctttgtcatcctttgtcccttcccagaagacatatcctggc
aactatggtttccaattaggattcctgaattctgggacagccaagtctgtaacctgcacg
tactcccctaccctcaataagctgttttgccagttggcaaaaacctgccccgtacagctg
tgggtcagctccccacccccacttggcacccgtgtccgagccatggccatctacaagaag
tccgagtacatgacagaggttgtgaggcgctgcccccaccatgagcgctgctctgacaat
agcgatggtttggcccctcctcagcatcttatccgggtggaaggaaatttgcgtgcagag
tatttggacgacaaaaacacttttcgacatagtgtggtggtgccctatgagccgcctgag
gtgggctctgactgtaccaccatccactacaacttcatgtgtaacagctcctgtatgggg
ggtatgaaccggcggcccatcctcaccataatcacactagaagactccagtggtactctc
ctgggacggaacagcttcgaggtgcgcatttgcgcctgtccagggagagaccgtcgtaca
gaggaagaaaatttccgcaagaaaggggagccttgtcccaagcagccccctgggagcagt
aagcgagcactgcccaacaacaccagctcctctcccccgccaaaggtgccacgggatgga
gaatatttcacccttcagatccgtgggcgtgaacgcttcgagatgtttcaagaactgaat
gaggccttggagctgaaggatgcccaggctggaaaggagtcagggggaagcagggctcac
tccagccatctgaagtctaagaaggggcaatctacttcccgtcataaaaaactcatgctc
aagagggaaggacttgactcagactga

DBGET integrated database retrieval system