KEGG   Hipposideros armiger (great roundleaf bat): 109394819
Entry
109394819         CDS       T04661                                 

Gene name
CXCL8
Definition
(RefSeq) C-X-C motif chemokine ligand 8
  KO
K10030  interleukin 8
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04060  Cytokine-cytokine receptor interaction
hai04061  Viral protein interaction with cytokine and cytokine receptor
hai04062  Chemokine signaling pathway
hai04064  NF-kappa B signaling pathway
hai04072  Phospholipase D signaling pathway
hai04218  Cellular senescence
hai04620  Toll-like receptor signaling pathway
hai04621  NOD-like receptor signaling pathway
hai04622  RIG-I-like receptor signaling pathway
hai04657  IL-17 signaling pathway
hai04932  Non-alcoholic fatty liver disease
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai05132  Salmonella infection
hai05133  Pertussis
hai05134  Legionellosis
hai05135  Yersinia infection
hai05142  Chagas disease
hai05144  Malaria
hai05146  Amoebiasis
hai05161  Hepatitis B
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05200  Pathways in cancer
hai05202  Transcriptional misregulation in cancer
hai05219  Bladder cancer
hai05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    109394819 (CXCL8)
   04072 Phospholipase D signaling pathway
    109394819 (CXCL8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109394819 (CXCL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109394819 (CXCL8)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    109394819 (CXCL8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109394819 (CXCL8)
   04621 NOD-like receptor signaling pathway
    109394819 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    109394819 (CXCL8)
   04657 IL-17 signaling pathway
    109394819 (CXCL8)
   04062 Chemokine signaling pathway
    109394819 (CXCL8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109394819 (CXCL8)
   05202 Transcriptional misregulation in cancer
    109394819 (CXCL8)
  09162 Cancer: specific types
   05219 Bladder cancer
    109394819 (CXCL8)
  09163 Immune disease
   05323 Rheumatoid arthritis
    109394819 (CXCL8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109394819 (CXCL8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109394819 (CXCL8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109394819 (CXCL8)
   05135 Yersinia infection
    109394819 (CXCL8)
   05133 Pertussis
    109394819 (CXCL8)
   05134 Legionellosis
    109394819 (CXCL8)
  09172 Infectious disease: viral
   05164 Influenza A
    109394819 (CXCL8)
   05161 Hepatitis B
    109394819 (CXCL8)
   05163 Human cytomegalovirus infection
    109394819 (CXCL8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109394819 (CXCL8)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109394819 (CXCL8)
   05144 Malaria
    109394819 (CXCL8)
   05142 Chagas disease
    109394819 (CXCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hai04052]
    109394819 (CXCL8)
   00536 Glycosaminoglycan binding proteins [BR:hai00536]
    109394819 (CXCL8)
Cytokines and growth factors [BR:hai04052]
 Cytokines
  Chemokines
   109394819 (CXCL8)
Glycosaminoglycan binding proteins [BR:hai00536]
 Heparan sulfate / Haparin
  Chemokines
   109394819 (CXCL8)
SSDB
Motif
Pfam: IL8 GCK
Other DBs
NCBI-GeneID: 109394819
NCBI-ProteinID: XP_019520860
LinkDB
Position
Un
AA seq 101 aa
MTSRLAVALLAAFLLSAALCEDAVVSRIATELRCQCINTHSEYFHPRYIKELRVIESGPH
CANSEIIVKLIGGKEVCLDPKAKWVQKVVQIFLKRAEKKSP
NT seq 306 nt   +upstreamnt  +downstreamnt
atgacttccaggctggccgtggctctcttggcagctttcctgctttctgcagctctgtgt
gaagatgcagttgtgtcgagaatagctacagaacttcgatgccagtgcataaacacccac
tctgaatatttccaccccagatatatcaaagaattaagagtgattgagagtggaccacac
tgtgcaaattcagaaatcattgtaaaactcatcggtggaaaagaggtctgcctggacccc
aaggcaaagtgggtgcagaaggttgtacagatatttttgaagagagctgagaagaaaagt
ccatga

DBGET integrated database retrieval system