KEGG   Hipposideros armiger (great roundleaf bat): 109395452Help
Entry
109395452         CDS       T04661                                 

Gene name
EZH2
Definition
(RefSeq) enhancer of zeste 2 polycomb repressive complex 2 subunit
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00310  Lysine degradation
hai05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109395452 (EZH2)
 09160 Human Diseases
  09161 Cancers: Overview
   05206 MicroRNAs in cancer
    109395452 (EZH2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hai03036]
    109395452 (EZH2)
Enzymes [BR:hai01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109395452 (EZH2)
Chromosome and associated proteins [BR:hai03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109395452 (EZH2)
   Polycomb group proteins
    PRC2-EZH2 complex
     109395452 (EZH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRC2_HTH_1 SET EZH2_WD-Binding preSET_CXC
Motif
Other DBs
NCBI-GeneID: 109395452
NCBI-ProteinID: XP_019521991
LinkDB All DBs
Position
Un
AA seq 754 aa AA seqDB search
MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKIVERTEILNQEW
KQRRIQPVHILTSVSSLRGTRECSVTSELDFPTQVIPLKTLSAVASVPIMYSWSPLQQNF
MVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQ
YNDDDDDDDDDDGDDPDETEEKQKDVEESRDDKESCPPRKFPSDKIFEAISSMFPDKGTA
EELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLH
RKCNYSFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGG
RRRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGESNDKEEEEKKDETSSSSEANS
RCQTPIKMKPNSEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVK
ESSIIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDS
SCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAAD
HWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEAD
RRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFA
KRAIQTGEELFFDYRYSQADALKYVGIEREMEIP
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atgggccagactgggaagaaatctgagaagggaccagtttgttggcggaagcgtgtaaaa
tcagagtacatgcgactgcgacaactcaagaggttcaggcgagctgatgaagtaaagagt
atgtttagttccaatcgtcagaaaattgtggaaagaacggaaatcttaaaccaggagtgg
aagcagcgaaggatccagcctgtgcacatcctgacttctgtgagctcattgcgcgggacc
agggagtgttcggtgaccagtgagttggattttccaacacaagtcatcccattaaagact
ctgagtgcagttgcttccgtgcccataatgtactcttggtctcctctacagcagaacttc
atggtggaagatgaaactgttttacataatattccttatatgggggatgaagttttagac
caggatgggactttcattgaagaactaataaaaaattatgacggaaaagtacatggggat
agagaatgtgggtttataaatgatgaaatttttgtggagttggtgaatgctcttggtcag
tacaatgatgacgatgatgatgatgatgacgatgatggagatgatcctgatgaaacagaa
gaaaaacagaaagatgtagaggagagccgagatgataaagaaagctgcccacctcggaaa
tttccttctgataaaatttttgaagccatttcctccatgtttccagataagggcacagca
gaggaactaaaggaaaagtataaagaactcaccgaacagcagctgcctggtgcacttcct
cctgaatgcaccccaaacatagatggaccaaatgccaaatctgtgcagagggagcaaagc
ctgcattcatttcatacgcttttctgtagacgatgttttaaatatgactgcttcctacat
cgtaagtgcaattattcttttcatgcaacacccaacacttacaagcggaagaacacagaa
acagctctggacaacaaaccctgtgggccacagtgttaccagcatctggagggagcgaag
gagttcgctgctgccctcacggctgagcggatcaagactccccccaaacgcccagggggc
cgcaggagggggaggctccccaacaacagcagccggcccagcacccccaccatcaacgtg
ctggagtccaaggacacggacagtgaccgggaagccgggaccgagactggcggtgaaagc
aacgataaggaggaggaggagaagaaagacgaaacctccagctcctcagaagcgaattct
cggtgtcaaacaccaataaagatgaagcccaacagtgagccccccgagaatgtggagtgg
agcggggccgaggcctccatgttccgcgtcctcattggcacctactatgacaacttctgt
gccattgccaggctaattgggaccaaaacatgtagacaggtgtatgagttccgggtcaaa
gagtccagtatcatcgctccagctcctgccgaggacgttgatacgccgccacggaagaag
aaaaggaaacaccggttgtgggctgcacactgcagaaagatacagctgaaaaaagacggc
tcctctaaccacgtttacaactaccagccctgtgaccatccacgccagccttgtgacagt
tcgtgcccttgtgtgatagcacaaaatttttgtgaaaagttttgtcaatgtagttcagag
tgtcaaaaccgctttccgggatgccgctgcaaagcacagtgcaacaccaagcagtgccca
tgctacctggccgtccgagagtgcgaccctgacctctgtctcacctgtggggctgccgac
cactgggacagtaagaacgtgtcctgcaagaactgcagtattcagcggggctccaaaaag
catttactgctggcgccgtctgacgtggctggctgggggattttcatcaaagatcctgta
cagaaaaatgagtttatctcggaatactgtggtgagatcatttctcaagacgaagcggac
agaagagggaaagtgtatgacaaatacatgtgcagctttctcttcaacttgaataacgat
tttgtggtggacgcaacccgcaagggtaacaaaattcgttttgcaaatcattccgtcaat
ccaaactgctatgcaaaagtgatgatggtcaacggcgaccacaggatagggatctttgcg
aagagagccatccagaccggggaagagctgttttttgattacagatacagccaggccgat
gccctgaagtatgtgggcattgagagagagatggagatcccctga

DBGET integrated database retrieval system