KEGG   Hipposideros armiger (great roundleaf bat): 109395594Help
Entry
109395594         CDS       T04661                                 

Gene name
MGAM2
Definition
(RefSeq) maltase-glucoamylase 2 (putative)
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00052  Galactose metabolism
hai00500  Starch and sucrose metabolism
hai01100  Metabolic pathways
hai04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109395594 (MGAM2)
   00500 Starch and sucrose metabolism
    109395594 (MGAM2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    109395594 (MGAM2)
Enzymes [BR:hai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     109395594 (MGAM2)
    3.2.1.20  alpha-glucosidase
     109395594 (MGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 109395594
NCBI-ProteinID: XP_019522303
LinkDB All DBs
Position
Un
AA seq 2326 aa AA seqDB search
MARNLTVLEVLLIIFFLIVLAVDIFLLFLVFENTSDASFVPQCPEIPESERIDCVAGQLV
TEEVCRWQYKCCWKAVPNIDVPRCFFPRNWGYEVSSGLKNTSTGFTAQLKRLPTPSLFGN
DIIDALLTAEYQTSNRFHFKITDLNNVRYEVPHENINVFNGTATTSNLSYHIKVTDKPFS
IKIIRTSNKRVMLDTSIGPLQFAQQYLQLSLRLPSANVYGLGEHVHQQYRHNMAWKTWPI
FTRDATPTQGPINLYGAHTFFLCLEDSSGASFGVFLMNSDAMEVILQPAPAVTYRTIGGI
LDFYVFLGNTPEQVVQEYLKLVGLPFLPSYWNLGFQLSRRDYGGINGLEKVVNRTLEAGI
PYDVQYHDVDYMDGKKDFTFESSRLPDFTNRLHSEYGLKYIIIMHPGILHNSFYQPYASG
SKKRVWILGNSGFLIGQGYPGKSVFPDYSNPACTEWWTNEFQEFHKNLSFDGVWIDMDEL
STFPQGSDHGCEKNSLNFPPFTPRILDRLLFSRTLCMDAEFYGGFHYDVHSLYGYMMARA
TDSAMKQIFSDKRNFILSRSTFAGSGKFAAHWLGDNAATWDDLRWSIPSILEFNLFGIPM
VGANICGYAKNVTEELCRRWMQLGAFYPLSRNHNGPGFRDQDPAAFGEDSQLLISSRHYL
KMRYFLLPYLYTLFYRAHTRGDTVARPMVHEFYQDPATWDVHEQFLWGPGLLITPVLYEG
VDRVKAYIPDAIWYDCETGAAIEWRKQWVEMLLPPDKIGVHFRGGYIFPTQEPNTTTETS
RKNSLGLIVALDHKREAKGELYWDDGVSTDAVTEKKYILYNFSVTSNHLHANIITNNYMD
NDSLMFTNIRIMGMDKQPTNFTAFVEKDFISKLSFSYNASLKMVVVSDLTNLALGKNFSI
KWDLPVSDLEKFNCYPEDPAVSEETCRQRECLWEPTTVPGVPTCFYDTIPKFAASNIQYL
PTGITTDLTHLMTLESARVASPPQDTQPPSAAKAATSDPLSAEISFLRLRVIYHTENMLQ
FKIYDPTSKRYEVPVPLNTPPAPVGSPEKRLYDVKVQTNPFGIQIQRKSSNTVIWDSQLP
GFTINDKFLSISTRLPSENLYGFGESEHTSFRRNISWNTWGMFARDEPPGYKKNSYGVHP
YYMGLEEDGSAHGVLLLNSNAMDVTLQPTPALTYRTTGGILDFYMVLGPTPELVAQQYTE
LIGRPAMVPYWALGFQLSRYGYRNATEISDLYDKMMAAQVPYDVQHVDIDYMDRKLDFTL
STHFQNLGPLIERMKTNGMRFVLILDPAISGNETQYLPFTRGQENNVFITWPNTSDIVWG
KVWPDLPNVNVDESLDHETQVKLYRAHVAFPDFLRNSTAAWWKNEIKELYINPREPAKSL
KFDGLWIDMNEPSNFVDGSVRGCSDEALNNPPYMPHLESSDRGLSSKTLCMESEQILPDG
SRVRHYDVHSLYGWSQTRPTYEAVQEVTGQRGVVITRSTFPSSGRWGGHWLGDNTAAWDQ
LRKSIIGMMEFSLFGISYTGADICGFFGDAEFEMCVRWMQLGAFYPFSRNHNSIGTRNQD
PVAWNSTFEMYSRDVLQTRYTLLPYLYTLMHKAHAEGSTVIRPLLHEFSGDSTTLTIDRQ
FMLGPAILISPVLDSGTFEVLAYFPRGRWYDYSTESGSVSVGGWRSLQAPLHHINLHIRG
GYILPWQEPAMNTHSSRQKFMGLIVALDDNEEAVGQMFWDDGQSIDTYENGNYFLANFTA
AQNILKIHTIHNKYLSDSNPLKVGYIKIWGINSTYVSQVSVTYDNKQFVEKNFSSDYFKQ
TLTIQLTDKIISLEKLTEVTWIHSDPIVPTTIMTTTSVHPSTFTTRATTSETITTRSATT
SITTASTSTHFPITTTPFTTSTTEVTSSTTITDSTTPLPTSTTTVSTSTPLPITTTWFTT
STTEVTSSTTITDSTTSFPTNTTTAGPSTAFPLTTSVFPTNTTEVTSNATITNITTPFPT
NTTTAXXXXXXXXXXXXFPTNSTEVTSSAAITNITTTFSTNTTTASTSTAFSITTTVYPT
NATEVTSKHPITDSTTPFSTNTTNASTSTAFPITTTPFPTTITDTSTGTTVLITTTLSPI
GTNATNTNDTVPVTTPSITNSLSTGSTTTGTLNSTYTTFSITTATDTPVSTTQSLFPPTT
TNTTQLTTPHSATTATQALSQTTLISTNFPNPGTINTTSASTASTSMDSVTTSTMRHTGH
VVNITDTNGTSSVPGDTTHVSIPNSTDSDTLTSALPATATHHLVTNSTTSYLPIIATNTT
TDITSITMYTSNTTTRITNNTNTTTTDASTTASTPIANTTSSAVVP
NT seq 6981 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaatctcactgtattggaagtccttctgatcatcttcttcctaattgtcttg
gccgtagatatcttcttgctgtttctggtgttcgagaatacttcagatgcttcatttgtt
ccacagtgcccagagatccccgaatcagaaaggatagactgcgtggctggccagctggtg
acagaggaagtctgcagatggcaatataagtgctgctggaaggctgtaccaaatattgat
gtccctaggtgcttcttccccaggaactggggctatgaagtcagcagtggccttaaaaat
acaagcacaggttttactgcccagttgaagaggttgccaaccccatctctgtttggcaat
gacatcatcgatgccctcctcacagctgaatatcagacatctaatcgttttcattttaag
atcactgatctcaataatgtacgctatgaagtcccccatgaaaatattaatgtgtttaat
gggactgctactacttccaatttgagctatcacatcaaggtcaccgataaacccttcagc
atcaaaataataaggacgagcaacaaaagggtcatgttggacaccagcatcgggcccctc
cagtttgcccagcagtatctgcagctgtctctccggctgcccagtgccaacgtatatgga
ctgggagaacatgtgcaccagcagtaccgccacaacatggcctggaagacgtggcccatc
ttcacgcgggatgccacccccacccagggcccgattaacctgtatggcgctcacacgttc
ttcctgtgccttgaagactcaagcggcgcctcttttggggtttttctgatgaacagtgac
gctatggaggtcatccttcagcctgctcctgcagtcacttaccgcacgatcgggggcatt
cttgatttttatgtgttcctgggaaatactccagagcaagtggttcaagaatacctgaag
ctcgttggactaccattcctaccttcttactggaatcttgggttccagcttagtcgcagg
gattatggtggcatcaacggtttggaaaaggttgtaaaccgaactctggaagctgggatc
ccatatgatgtccaataccatgatgtagactacatggatggaaaaaaggatttcactttt
gagtcctcacgtctcccagattttaccaatcgcttacatagtgaatatggactaaaatat
ataatcattatgcatcctggcattttacataattctttctaccaaccctatgcaagtgga
agtaaaaagagagtatggatcttggggaacagtggctttctcattgggcaggggtatccg
ggaaaatcagtctttcctgattacagtaatccagcctgtactgagtggtggacaaacgag
ttccaggagttccataaaaatctgagttttgatggagtgtggattgacatggatgaatta
tcgacctttcctcaaggttctgatcacgggtgtgaaaaaaacagcttgaactttcctcct
ttcactcctcgaattctggaccgcttgctgttttcaagaaccctttgcatggatgccgag
ttttacgggggctttcactatgatgtccacagcttgtatggctacatgatggcaagagcc
acagactcggccatgaagcagatcttctccgataagaggaacttcatcttatcccgttct
acttttgctggatctggcaaatttgctgctcattggttgggggacaatgcggccacatgg
gatgatcttcgatggtccatccctagtatccttgagttcaatctatttggcatccccatg
gtcggtgccaacatctgtggttatgcaaaaaatgtcacagaggagctctgcagaagatgg
atgcagcttggagcattttatccactatcgaggaatcacaatgggcctgggttcagggac
caggatcccgctgcctttggtgaagactctcagctgctgatctcctccagacactatctg
aagatgcgctacttcctgctgccctatctctacacccttttctaccgcgctcatacccgt
ggcgacactgtagcaaggcccatggtccatgagttctaccaggacccagctacctgggat
gtgcacgagcagttcttatgggggcctggactcctcatcacgccggttctttatgaaggt
gtggaccgagtgaaagcatacatcccagacgccatctggtacgactgcgagacaggagca
gccattgaatggaggaaacaatgggtggagatgcttctgccccctgataagataggcgtt
cactttcgagggggctacatattccccacccaggagccaaacacaaccacagagacgagt
cggaaaaattctctgggactcattgttgccttggaccacaagagagaagcaaagggcgag
ctgtactgggacgatggtgtgtctacagatgctgtaacggaaaagaaatatattctgtat
aatttttctgtcacctctaaccatctacatgcaaatattataactaataattatatggac
aatgacagcctcatgtttacaaatatcagaatcatgggaatggacaaacaacctaccaac
tttactgcctttgttgagaaggatttcatctccaaattatccttttcctacaacgcttca
ttgaagatggtggtagtctctgatctcacgaacctggccctggggaaaaatttctccatt
aagtgggatcttccagtcagtgacctggagaagttcaactgctaccctgaggatcccgct
gtttctgaggagacttgtaggcagcgggagtgcctttgggagcccacaactgttcctggc
gtgcccacctgcttctatgacaccatccctaagtttgctgccagtaacattcagtatttg
cccactggcatcaccacagaccttacccacctgatgacccttgagtcagcaagagtggca
tcaccaccacaggacacgcaacccccatccgcagcaaaggcggccacctcggatcctctc
tctgcagagatcagcttccttcgcctcagggtgatctatcacacagaaaacatgctgcag
ttcaagatctatgatcccaccagtaaaaggtatgaggtgccagtgcctctgaacacccct
cccgctcctgtcggctcccctgaaaagcgtctgtacgatgtcaaggtgcagaccaatcct
ttcgggattcagattcaacggaaaagctccaacaccgtgatttgggactctcagctcccc
ggcttcaccatcaatgacaagttcctttccatctccacgcgcctcccctctgagaacctc
tatggctttggggaaagcgagcacacgagtttcaggaggaacatcagctggaacacgtgg
ggaatgtttgctcgagatgaaccgccggggtacaagaagaattcctatggcgtccacccc
tactacatgggactggaggaagatggcagcgcccacggagtgctcctgctaaacagcaac
gccatggatgtgacactccagcccacacctgccctgacgtaccgcaccacaggagggatt
ttggacttttatatggttttggggccaacccccgagcttgtagctcagcaatacaccgag
ttgattggccgtccagcaatggttccgtactgggctttggggttccagctgagtcgctat
ggataccggaacgctactgaaatctccgatttgtatgataaaatgatggcagcccaggtt
ccctatgatgttcagcatgtcgacatagactacatggaccggaagctggacttcaccctc
agcacccactttcaaaacctcggtcccctgattgagcgaatgaagacaaatggcatgaga
tttgtcctcatcctggatccagccatttctggcaacgagacccagtatctcccatttacc
agagggcaggaaaacaacgtattcatcacatggcccaacaccagtgatattgtctgggga
aaggtttggccagatctacccaacgtgaatgtggatgaatcccttgaccatgaaactcag
gttaagctgtacagagcccacgttgcttttcctgacttcctgcgtaacagcacagctgca
tggtggaagaacgaaatcaaagaactctacatcaaccctcgagagccagcgaagagcttg
aagtttgatggattgtggatcgatatgaatgagccatcaaactttgtggatggatctgtc
aggggttgcagtgatgaagctcttaataacccaccctatatgccacatctggagtccagc
gacaggggcctgagcagcaaaaccctgtgcatggagagcgagcagatcctgccagatggc
tcccgggtgcggcactacgacgtgcacagcctgtacgggtggtcccagaccagacccacc
tacgaagctgtgcaggaggtgacggggcagcgaggggttgtcatcacccgttccacattc
ccctcttctggccgctggggaggccactggctgggagacaacacagctgcgtgggaccag
ctgaggaagtctatcattggcatgatggagttcagtctctttggaatatcttatacagga
gcagatatttgtgggttctttggagacgctgaatttgagatgtgtgttcgctggatgcaa
ctgggggccttctatccattttccaggaaccacaacagcatcgggacacggaatcaagat
cctgtggcctggaactcgacctttgagatgtactcgagagatgtcctccagaccaggtat
accctgctgccgtacctctacacgctgatgcacaaagctcacgctgagggcagcactgtc
atccgaccccttctccatgagtttagcggtgacagcacaacgttgacgatagaccgtcag
ttcatgctgggccctgccatcttaatcagccccgtgctggacagtggcacctttgaggtc
ctcgcttattttcccagaggccgttggtatgactatagcacggaatcgggcagtgtatcc
gtaggtgggtggagatccctgcaggctccgcttcaccacatcaaccttcacatcagaggc
ggctacatcctgccttggcaagagcctgccatgaacacccactccagtcgacaaaaattt
atgggattgattgttgctttggatgacaatgaggaggctgtaggccagatgttctgggat
gatggacaaagcattgatacctatgaaaatggcaactatttcttggcaaattttacagca
gctcagaacatattgaaaatccacaccatacacaataagtatttgagtgactcgaatcca
ctgaaagttggatatattaaaatctggggaataaactctacttatgtgtcacaagtcagt
gttacctatgacaacaagcaattcgtggagaagaatttctcgagtgactacttcaaacag
acactaactattcaattaactgacaagattatcagcctggaaaagttaactgaggtcact
tggattcacagtgatcccatagttccgactacaattatgacaacgacgtcggtacatcct
tctacatttactactagggctaccacttctgagactattaccactaggtctgctactaca
agtattactactgcgagcactagtactcattttcctatcacaaccactccgttcacaaca
agtactacagaagttacatcaagtactactattactgatagcactactcctctgcctaca
agtactactactgttagcactagtactcctttgcctatcacaaccacttggttcacaaca
agcactacagaagttacatctagtactactattactgatagcactacttctttccctaca
aatactactactgctggccctagtactgcctttcctctcacaacctctgttttcccaaca
aatactacagaagttacatctaatgctactattactaatatcactactcctttccctaca
aatactactactgcnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnntttcccaaca
aattctacagaagttacatctagtgctgctattactaatatcactactactttctctaca
aacactactactgctagcactagcactgccttttctatcacaaccactgtttacccaaca
aatgctacagaagttacttctaaacatcctattacagatagcactactcctttttctaca
aatactactaatgctagcactagtactgcctttcctatcacaaccactccttttccaaca
actattactgatactagcactggtactactgttcttataaccactactctttccccaata
ggtactaatgctactaacactaatgatactgttccagttacaactccttctattacaaac
agcctctctacaggcagtacaacaactggtacccttaactccacatatactaccttttct
ataacaactgctacagacacaccagtctctactacccagtctctatttccccctactacc
accaacaccacacagctcactactccccattctgctactactgcaacacaggccctaagc
caaacaacattaatttccacaaattttcctaacccaggcaccatcaacactacttccgca
agcactgcatccactagcatggattcagttactaccagtactatgaggcatacagggcat
gtagtaaatattactgataccaatggtaccagcagtgttccaggtgacacgacacatgtt
tctattccaaattcaacagattcagacacactaacgtctgctcttccagctacagccact
catcatctagtaacaaattctacaactagttatttacctattattgcaactaatactacc
acagatattacaagtattaccatgtatacttcaaatactaccactagaataaccaataat
accaatacaacaacaacagatgcttctactactgcatctactcctattgcaaataccaca
agttctgctgtagttccctga

DBGET integrated database retrieval system