KEGG   Hipposideros armiger (great roundleaf bat): 109395605
Entry
109395605         CDS       T04661                                 

Gene name
BRAF
Definition
(RefSeq) B-Raf proto-oncogene, serine/threonine kinase
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai04010  MAPK signaling pathway
hai04012  ErbB signaling pathway
hai04015  Rap1 signaling pathway
hai04024  cAMP signaling pathway
hai04062  Chemokine signaling pathway
hai04068  FoxO signaling pathway
hai04150  mTOR signaling pathway
hai04270  Vascular smooth muscle contraction
hai04510  Focal adhesion
hai04650  Natural killer cell mediated cytotoxicity
hai04720  Long-term potentiation
hai04722  Neurotrophin signaling pathway
hai04726  Serotonergic synapse
hai04730  Long-term depression
hai04810  Regulation of actin cytoskeleton
hai04910  Insulin signaling pathway
hai04914  Progesterone-mediated oocyte maturation
hai04928  Parathyroid hormone synthesis, secretion and action
hai04934  Cushing syndrome
hai05010  Alzheimer disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05034  Alcoholism
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05200  Pathways in cancer
hai05205  Proteoglycans in cancer
hai05210  Colorectal cancer
hai05211  Renal cell carcinoma
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05216  Thyroid cancer
hai05218  Melanoma
hai05219  Bladder cancer
hai05220  Chronic myeloid leukemia
hai05221  Acute myeloid leukemia
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109395605 (BRAF)
   04012 ErbB signaling pathway
    109395605 (BRAF)
   04015 Rap1 signaling pathway
    109395605 (BRAF)
   04068 FoxO signaling pathway
    109395605 (BRAF)
   04024 cAMP signaling pathway
    109395605 (BRAF)
   04150 mTOR signaling pathway
    109395605 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109395605 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109395605 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109395605 (BRAF)
   04062 Chemokine signaling pathway
    109395605 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109395605 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    109395605 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    109395605 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109395605 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    109395605 (BRAF)
   04720 Long-term potentiation
    109395605 (BRAF)
   04730 Long-term depression
    109395605 (BRAF)
   04722 Neurotrophin signaling pathway
    109395605 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109395605 (BRAF)
   05205 Proteoglycans in cancer
    109395605 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109395605 (BRAF)
   05212 Pancreatic cancer
    109395605 (BRAF)
   05225 Hepatocellular carcinoma
    109395605 (BRAF)
   05226 Gastric cancer
    109395605 (BRAF)
   05214 Glioma
    109395605 (BRAF)
   05216 Thyroid cancer
    109395605 (BRAF)
   05221 Acute myeloid leukemia
    109395605 (BRAF)
   05220 Chronic myeloid leukemia
    109395605 (BRAF)
   05218 Melanoma
    109395605 (BRAF)
   05211 Renal cell carcinoma
    109395605 (BRAF)
   05219 Bladder cancer
    109395605 (BRAF)
   05215 Prostate cancer
    109395605 (BRAF)
   05213 Endometrial cancer
    109395605 (BRAF)
   05224 Breast cancer
    109395605 (BRAF)
   05223 Non-small cell lung cancer
    109395605 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109395605 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    109395605 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    109395605 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109395605 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    109395605 (BRAF)
   05160 Hepatitis C
    109395605 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109395605 (BRAF)
   01522 Endocrine resistance
    109395605 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109395605 (BRAF)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109395605 (BRAF)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   109395605 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 109395605
NCBI-ProteinID: XP_019522312
LinkDB
Position
Un
AA seq 818 aa
MAALSGGGGGGGGAEQGQALFNGDMEPEAGAGAAASSAADPAIPEEVWNIKQMIKLTQEH
IEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASTDTV
TSSSSSSLSVLPSSLSVFQNPTDVSRSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDS
LKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRK
TFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPI
PQEEASLAETSLTSGSSPSAPPDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRD
RSSSAPNVHINTIEPVNIDEKFPEVELQDQRDLIRDQGFRSDGAPLNQLMRCLRKYQSRT
PSPLLHSVPSEIVFDFEPGPVFRGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSS
SSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTA
PTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFE
MIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQ
FEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMV
GRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHRSAS
EPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFAAFK
NT seq 2457 nt   +upstreamnt  +downstreamnt
atggcggcgctgagcggcggcggcggcggcggcggcggcgcggagcagggccaggctctg
ttcaacggggacatggagcccgaggccggcgccggcgccgcggcctcctcggctgcggac
cctgccatcccggaggaggtgtggaacatcaaacaaatgattaagttgacacaggaacat
atagaggccctattggacaaatttggtggagagcataatccaccatcaatatatctggag
gcctatgaagaatacaccagcaagctagatgccctccaacaaagagaacaacagttattg
gaatccctggggaatggaactgatttttctgtttctagctctgcatcaacggacaccgtt
acatcttcttcctcttctagcctttcagtgctaccttcatctctttcagtttttcaaaac
cccacagatgtgtcacggagcaaccctaagtcaccacaaaaacctattgttagagtcttc
ctgcccaacaaacagaggacagtggtacctgcgaggtgtggcgttacagtccgagacagt
ctaaagaaagcactgatgatgagaggtctaatcccagagtgctgtgccgtttacagaatt
caggatggagagaagaagccaattggctgggacactgatatttcctggcttaccggcgag
gagttgcatgtagaagtattggagaatgttccactgacaacacacaactttgtacggaaa
acttttttcaccttagctttttgtgacttttgtcgaaagctgcttttccagggtttccgc
tgtcaaacatgtggttataaatttcaccagcgctgtagcacagaagttcctctgatgtgt
gttaattatgaccaacttgatttgctgtttgtctccaagttctttgaacaccacccaata
ccacaggaggaggcctccttagcagagacttcccttacgtctggatcgtccccttctgca
ccccccgattctattgggccccaaattctcaccagtccgtctccttcaaaatccattcca
attccacagcctttccgaccagcagatgaagatcatcgaaatcagtttggacaacgagac
cggtcctcgtcggctccaaacgtgcatataaacacaatagaacctgtcaatattgatgaa
aaattcccagaagtggaattacaggatcaaagggacttgattagagaccaagggtttcgt
agtgatggagcccctttgaaccagctgatgcgctgtcttcggaaataccaatcccggact
cccagccccctcctccattctgtccccagtgaaatagtgtttgattttgagcctggccca
gtgttcagaggatcaaccacaggtttgtctgccacgccccctgcctcattacctggctca
ctcactaatgtgaaagcactacagaaatctccaggacctcagcgggaaaggaagtcatct
tcatcctcagaagacaggaatcgaatgaaaacacttggtagacgggattcaagtgatgat
tgggagattcctgatggccagatcacagtgggacaaagaattggatccgggtcatttggg
acagtctacaagggaaagtggcatggtgatgtcgcagtgaaaatgttgaatgtgacagca
cccacacctcagcagttacaggccttcaaaaatgaagtaggcgtactcaggaaaactcga
catgtgaatatcctactcttcatgggctattccacaaagccacaactggctattgttaca
cagtggtgtgagggctccagcttatatcaccatctccacatcattgagaccaaatttgag
atgatcaaacttatagatatcgcacggcagactgcacagggcatggattacttacacgcc
aagtcaatcatccacagagacctcaagagtaataatatttttcttcacgaagacctcaca
gtaaaaataggtgattttggtctagccacagtgaaatctcgatggagtgggtcccatcag
tttgaacagttgtctggatccatcttgtggatggcaccagaagtaatcagaatgcaagat
aaaaacccctatagctttcagtcagatgtgtatgcatttgggattgttctgtatgaattg
atgactggacagttaccttattcaaacatcaacaacagggaccagataatttttatggtg
ggacgaggatatctatctccagatctcagtaaggtacgaagtaactgtccaaaagccatg
aagagattaatggcagagtgcctgaaaaagaaaagagatgagagaccactctttccccaa
attctcgcctctattgagctgctggcccgctcattgccaaaaattcaccgcagtgcatca
gaaccctccttgaatcgggctggcttccaaacagaggactttagtctatatgcttgtgct
tctccaaaaacgcccatccaggcggggggatatggagaatttgcagccttcaagtag

DBGET integrated database retrieval system