KEGG   Hipposideros armiger (great roundleaf bat): 109395610Help
Entry
109395610         CDS       T04661                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00052  Galactose metabolism
hai00500  Starch and sucrose metabolism
hai01100  Metabolic pathways
hai04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109395610 (MGAM)
   00500 Starch and sucrose metabolism
    109395610 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    109395610 (MGAM)
Enzymes [BR:hai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     109395610 (MGAM)
    3.2.1.20  alpha-glucosidase
     109395610 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 109395610
NCBI-ProteinID: XP_019522328
LinkDB All DBs
Position
Un
AA seq 1822 aa AA seqDB search
MARKKLKSFTNLELMLSALLLVVFVITIPLFVLSARESLGLKDAETSTTPAPPECPVPNE
VERINCIPEQTPNKAICEQRGCCWNPQGTIRVPWCYYSKSHGYQMEGDFANTKAGFTAQL
KRLPSPSPFGNDVNNVLLTAEYQTSNRFHFKLTDSKKDRYEVPHEHVQAFQGDAASPLTY
KVEVSPQPFSIKVRRESNSVVLLDSSIGPLLFADQFLQFSFRLPSANVYGLGEHVHQQYR
HDMNWKTWPIFARDTTPNGDGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMDVVLQPTP
AVTYRTTGGILDFYVFLGNTPEQVVQEYLELIGRPALPAYWTLGFHLSRYDYGTLDNMKQ
VVERNRAAQLPYDVQHADIDYMDERKDFTYNPVDFKGFPDFAKELHNNGQKLVIIVDPAI
SNKSSPSNPYGPYDRGSDMKIWVNASDGVTPLVGEVWPGKTVFPDYTNPRCAVWWANEFK
LFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTSNLNYPPFTPRVLDGHLFCKTLCMDAVQH
WGKQYDVHNLYGYSMAIATAEAVKTVFPSKRSFIVTRSTFAGSGKFAAHWLGDNAATWND
LRWSIPGMLEFNLFGIPMVGPDICGYAMDAPEELCRRWMQLGAFYPFSRNHNGQGYKAQD
PASFGADSLLLNSSRHYLTIRYTLLPYLYTLFYRAHRHGDTVARPLLHEFYKDSNTWDVH
QQFLWGPGLLITPVLHEGAKKVTAYIPDATWYDYETGRQVSWRKQKVEMELPGDKIGLHL
RGGYIFPIQQPATTTVASRRNPLGLIIALDDNKEAKGELFWDDGETKDTVADKVYILCEF
SVTQNRLDVKILQSTYQDPNNLAFKEIKILGIQKLMNITVKHNGVLSQVSPNVTYDSNLQ
VALITGLDLVLGEAYTVEWNLEIQDAEKIDCYPDENGASAENCAARGCAWEASSTPGVPF
CYFINDLYSVSDVQYDSHGATAIISLKSSLYANAFPSTPVNPLRLTVTYHKNDMLQFKIY
DLNNSRYEVPVPLNLPRVPSSTFESRLYDVFIKKSPFGIEIRRRSTGSVIWDSQLLGFTF
NDMFIRISTRLPSPYIYGFGENEHTAYRRDLNWHTWGMFSRDQPPGYKKNSYGVHPYYMG
LEEDGSAHGVLLLNSNAMDVTFQPLPALTYRTTGGILDFYVFLGPTPELVTQQYTEVIGR
PVMVPYWALGFQLCRYGYQNDSEIASLYDDMVAAQIPYDVQYSDIDYMERQLDFTLNPKF
AGFPALINRMKSDGMRVILILDPAISGNETKPYPAFTRGVEDDVFIKDPNGGGIVWGKVW
PDFPDVVINSSLDWESQVEQYRAYVAFPDFFRNSTATWWKREMKELHSNPQEPDKSLKFD
GMWIDMNEPSSFVNGAVPPGCKDDTLNHPPYMPHLESRDRGLSSKTLCMESEQILPDGSR
VRHYDVHSLYGWSQTRPTYEAVQEVTGQRGIVVTRSTFPSSGRWGGHWLGDNTAAWDQLR
KSIIGMMEFSIFGISYTGADICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPV
SWDEAFVNMSRSVLKTRYTLLPYLYTLMHLAYTEGRTVVRPLLHEFVSDRVTWDIDRQFL
LGPAFLVSPVLDPNARNVTAYFPGARWYDYYTGVDIQARGEWKTLPAPLDHINLHVRGGS
ILPWQEPAQNTHFSRQKFIGLKVALDDKGAAEGWLFWDDGQSIDTYEKGLYYLAHFSASQ
NTIESHITFNNYITDTNPLRLGYIEIWGLNSLSVSNVSVSVKDTVITPSFNYIATIQVLS
IEMTNRNISLHNFISLTWTNTQ
NT seq 5469 nt NT seq  +upstreamnt  +downstreamnt
atggcgagaaagaagttgaaatcgttcactaatttagagcttatgctcagcgctctcctg
ctggtcgtgtttgtcatcaccattcctctatttgtcctctcagccagggagtctttggga
ttaaaagatgctgagacaagcaccacccctgcacctcctgagtgccccgtgccgaatgaa
gtggagcgtataaactgcatccctgagcagacacctaacaaggccatatgtgagcagcgt
ggctgctgctggaatccccagggaaccatccgtgtgccctggtgctactattccaagagt
catggctatcagatggagggcgactttgccaacacaaaggcaggattcacagcccagttg
aaaaggttgccttctccgtccccatttggaaatgacgtcaacaatgtccttctcacagcg
gaataccagacatcgaatcgcttccactttaagttaactgactcaaagaaggacaggtac
gaagtgccccatgaacatgtccaagccttccaaggagatgctgcttctcccttgacctat
aaagttgaggtctccccacagccattcagcatcaaagtgaggagagaaagcaacagtgtc
gttctgttggactcaagtatcgggcccctcctgtttgctgatcagttcctgcagttctcc
ttccgactgccaagtgctaacgtgtatggtctgggagaacacgtgcaccagcagtaccgc
catgatatgaactggaagacctggcccatatttgccagggacacaacccccaatggggat
ggaactaacttgtatggggcacagacattcttcctgtgccttgaagatgctagtggatta
tcctttggagtgtttctgatgaacagcaatgccatggacgtcgtcctccagcccacacca
gctgtcacttaccgcaccaccgggggcattctcgacttctatgtgttcttgggaaatact
ccagagcaagttgttcaagagtatctagagctcattggacggccagccctgcccgcatac
tggacacttggatttcatctcagtcgttatgactatggaaccctagataacatgaagcag
gttgtggagagaaaccgggcagcacagctcccttacgacgttcagcatgctgatattgat
tatatggatgagaggaaggacttcacttacaacccagtagattttaaaggctttcctgac
tttgctaaggagttacacaataacggacagaaattggtcatcattgtggatccagctatc
tccaacaagtcttccccaagcaacccctatggcccctatgacaggggttcagacatgaag
atatgggtgaatgcttcagatggagtgactccacttgttggggaggtctggcctggaaaa
actgtgtttcctgattacaccaaccccaggtgtgctgtttggtgggcaaatgaatttaag
ctttttcacaatcaagtggagtttgatggaatctggattgatatgaatgaggtctccaac
ttcgttgatggctctgtttcaggatgttccacaagcaacctaaattatcccccattcact
cccagagtcctggatgggcacctgttctgcaagaccctctgcatggatgccgtgcagcac
tggggcaagcagtatgatgtccacaatctctacggctactccatggccatcgccaccgca
gaggccgtcaagactgtgtttcctagcaagagaagcttcattgtaacccgttccaccttc
gcgggatcaggcaagtttgcagcccattggttaggagataatgcggccacctggaatgac
ctccgatggtccatccccggcatgcttgagttcaacctttttggtatcccaatggtgggt
cctgacatttgtggctatgcaatggatgccccggaggagctctgcagacggtggatgcag
ctgggagcattctatccattttccaggaatcacaatggccaaggctacaaggcccaggat
cctgcctcctttggagctgactctctgctgctgaattcctccaggcattacctaaccatc
cgctatactctgctgccctatctgtacaccctcttctatcgcgctcacaggcatggggac
acagtggccaggccccttctgcatgagttctataaggacagcaacacctgggacgtgcac
cagcagtttctctgggggcccggcctcctcatcaccccagttctgcatgagggtgccaag
aaagtgacggcatatatacctgatgccacctggtacgattatgagactgggcgccaagtg
agctggagaaagcaaaaagtggagatggaacttcctggagacaaaattggacttcacctt
cgaggaggctacatcttccctatccaacagccagccacaaccacggtggccagtcgacgg
aaccctcttggccttatcattgccctagatgacaacaaagaagcaaaaggcgaacttttc
tgggatgatggggaaacgaaagatactgtggctgataaagtctatatcctatgtgagttt
tccgtcacccaaaaccgcttggatgtgaagattttgcaatcaacctaccaagaccccaat
aatttagcatttaaagagattaagatccttgggatccagaaactgatgaacattacagtg
aaacacaacggtgtcctcagtcaagtttctcccaatgtcacttatgattctaacctacag
gttgcccttatcacagggcttgatcttgtcctgggagaagcatacacagtggagtggaac
ctggagatacaggatgcagaaaaaatagactgttatcccgatgagaatggtgcttctgca
gaaaactgtgctgcccgtggctgtgcctgggaggcatccagtactccaggagtccctttt
tgctacttcatcaatgatctctactctgtcagtgatgttcagtatgactcacacggggcc
acggctatcatctccttaaagtcctccctttatgccaacgctttcccctcaacgcccgtg
aaccccctccgtctgacggtgacctaccacaagaatgacatgctgcagttcaagatttat
gatctcaacaacagtcggtatgaagtcccagtccctctcaacttacccagggttccatcc
agcacctttgagagtcgactctatgacgtcttcattaagaagagtccatttgggattgaa
attcgccggaggagtacaggcagcgtaatttgggactctcagctccttggcttcaccttc
aatgacatgttcattcgcatctccactcgccttccctccccgtacatctatggctttggg
gaaaatgagcacacagcctatcggagagacttgaactggcacacgtgggggatgttctcc
cgagaccagcccccggggtacaagaagaattcctatggcgtccacccctactacatggga
ctggaggaagatggcagcgcccacggagtgctcctgctaaacagcaacgccatggatgtg
acattccagcccctgcctgccttgacgtaccgtaccacaggaggaattctggacttttat
gtgttcttggggccaactccagagcttgtcactcagcagtacacggaggtgattggtcgg
ccagtgatggttccctactgggccttggggtttcagctgtgtcgctatggataccagaat
gactctgagattgccagcttatatgatgacatggtggctgcccagatcccctatgacgtg
cagtactctgacatcgactacatggagcggcagctggacttcaccctcaaccccaagttt
gctggattcccagctctgattaatcgcatgaagagcgatgggatgcgggtcatcctcatt
ctggacccagccatttccggaaacgagacaaagccctatcctgcattcacacggggtgtg
gaggatgacgtctttatcaaagatcccaatggtggaggcattgtctggggaaaggtttgg
cctgattttcctgatgtcgttataaacagttctctagactgggagagccaagtggagcaa
taccgagcttatgtggccttcccagactttttccgtaattcgactgccacctggtggaag
agggaaatgaaagaactgcacagcaacccccaggagccagacaagagtttgaagtttgat
ggcatgtggattgatatgaatgaaccgtcaagctttgtgaacggggcggttcctccaggc
tgtaaagatgacactctgaaccaccctccctatatgccacatctggagtccagggacagg
ggcctgagcagcaaaaccctgtgcatggagagcgagcagatcctgccagatggctcccgg
gtgcggcactacgacgtgcacagcctgtacgggtggtcccagaccaggcccacctacgaa
gctgtgcaggaggtgacggggcagcgagggatcgtggtcacccgttccacattcccctct
tctggccgctggggaggccactggctgggagacaacacggctgcgtgggaccagctgagg
aagtctatcattggcatgatggagttcagcatctttggcatatcctatacaggagcagat
atttgtgggttctttcaagatgctgaatatgagatgtgtgttcgctggatgcaactgggg
gccttttaccccttttcgaggaaccacaacaccattggaacaaggaggcaagaccctgtg
tcctgggatgaggcctttgtgaatatgtccagaagcgtcctgaagaccagatacacgctc
ctgccctatctctacaccctgatgcacttggcctacacggagggcaggactgtggtgcgg
cctcttctccatgagtttgtgtcagaccgggtgacctgggatatagaccgtcagttcctg
ctgggccccgccttcctggtcagccctgtcctggatcctaatgccagaaatgtcaccgcg
tatttccctggagcccgctggtatgactactacacgggtgtggacatccaagccagggga
gagtggaagaccttgccagcccctcttgaccacattaacctccatgtccgcggaggctcc
atcctgccctggcaagaacctgcacagaacacccacttcagccgccagaaattcataggc
ttgaaggttgccttggatgataaaggggctgctgaaggttggctcttctgggatgatggg
caaagcatcgatacctatgagaaaggactctattacctggcccacttttccgccagccag
aatacgatagagagtcacataactttcaacaactacatcaccgatacaaaccctttgaga
ctcggctacattgagatctggggactgaacagtctctccgtttccaatgtcagtgtctct
gtgaaggacacggttataacacccagcttcaactacatcgctacaatccaggtgttaagt
attgagatgaccaacagaaacatcagcctccataatttcatttccttgacatggacaaac
actcagtga

DBGET integrated database retrieval system