KEGG   Hipposideros armiger (great roundleaf bat): 109395706
Entry
109395706         CDS       T04661                                 

Gene name
CASP3
Definition
(RefSeq) caspase 3
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01524  Platinum drug resistance
hai04010  MAPK signaling pathway
hai04115  p53 signaling pathway
hai04210  Apoptosis
hai04215  Apoptosis - multiple species
hai04650  Natural killer cell mediated cytotoxicity
hai04657  IL-17 signaling pathway
hai04668  TNF signaling pathway
hai04726  Serotonergic synapse
hai04932  Non-alcoholic fatty liver disease
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai05010  Alzheimer disease
hai05012  Parkinson disease
hai05014  Amyotrophic lateral sclerosis
hai05016  Huntington disease
hai05020  Prion disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05132  Salmonella infection
hai05133  Pertussis
hai05134  Legionellosis
hai05145  Toxoplasmosis
hai05146  Amoebiasis
hai05152  Tuberculosis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05203  Viral carcinogenesis
hai05205  Proteoglycans in cancer
hai05206  MicroRNAs in cancer
hai05210  Colorectal cancer
hai05222  Small cell lung cancer
hai05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109395706 (CASP3)
   04668 TNF signaling pathway
    109395706 (CASP3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109395706 (CASP3)
   04215 Apoptosis - multiple species
    109395706 (CASP3)
   04115 p53 signaling pathway
    109395706 (CASP3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109395706 (CASP3)
   04657 IL-17 signaling pathway
    109395706 (CASP3)
  09156 Nervous system
   04726 Serotonergic synapse
    109395706 (CASP3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109395706 (CASP3)
   05206 MicroRNAs in cancer
    109395706 (CASP3)
   05205 Proteoglycans in cancer
    109395706 (CASP3)
   05203 Viral carcinogenesis
    109395706 (CASP3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109395706 (CASP3)
   05222 Small cell lung cancer
    109395706 (CASP3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109395706 (CASP3)
   05012 Parkinson disease
    109395706 (CASP3)
   05014 Amyotrophic lateral sclerosis
    109395706 (CASP3)
   05016 Huntington disease
    109395706 (CASP3)
   05020 Prion disease
    109395706 (CASP3)
   05022 Pathways of neurodegeneration - multiple diseases
    109395706 (CASP3)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109395706 (CASP3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109395706 (CASP3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109395706 (CASP3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109395706 (CASP3)
   05133 Pertussis
    109395706 (CASP3)
   05134 Legionellosis
    109395706 (CASP3)
   05152 Tuberculosis
    109395706 (CASP3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109395706 (CASP3)
   05162 Measles
    109395706 (CASP3)
   05164 Influenza A
    109395706 (CASP3)
   05161 Hepatitis B
    109395706 (CASP3)
   05160 Hepatitis C
    109395706 (CASP3)
   05168 Herpes simplex virus 1 infection
    109395706 (CASP3)
   05163 Human cytomegalovirus infection
    109395706 (CASP3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109395706 (CASP3)
   05169 Epstein-Barr virus infection
    109395706 (CASP3)
   05165 Human papillomavirus infection
    109395706 (CASP3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109395706 (CASP3)
   05145 Toxoplasmosis
    109395706 (CASP3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109395706 (CASP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hai01002]
    109395706 (CASP3)
Enzymes [BR:hai01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     109395706 (CASP3)
Peptidases and inhibitors [BR:hai01002]
 Cysteine peptidases
  Family C14: caspase family
   109395706 (CASP3)
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 109395706
NCBI-ProteinID: XP_019522509
LinkDB
Position
Un
AA seq 285 aa
MTEELIKASMENTENSVDAKSIKNSETKILHGSKSMDSGISLDDSYKMDYPEMGLCIIVN
NKNFHKSTGMASRSGTDVDAANLRETFMNLKYEVRIKNDLTCEEIMDLMQSVSKEDHSKR
SSFICVLLSHGDEGRIFGTNGPVDLRILASFFRGDYCRSLTGKPKLFIIQACRGTELDCG
IETDSVEDDMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQALCAMLKQHAQKLEL
MHILTRVNRKVATEFESFSFDSTFHAKKQIPCIVSMLTKELYFCH
NT seq 858 nt   +upstreamnt  +downstreamnt
atgacggaggagttaataaaagcatccatggagaacactgaaaactcagtggatgcaaaa
tccattaaaaattcagaaacaaagattttacatggaagcaaatcaatggactctggaata
tccttggacgatagttacaaaatggattatcctgaaatgggtttatgtataatagtcaat
aataagaactttcataaaagtactggaatggcatctcggtctggtacagatgtagatgca
gcaaacctcagggaaacattcatgaacttgaaatacgaagtcaggattaaaaatgatctc
acatgtgaagaaattatggatttgatgcagagtgtttctaaagaagatcatagcaagagg
agcagttttatttgtgtgcttctaagccatggtgatgaaggaagaatttttggaacaaat
ggacctgttgacctgagaatattagcaagttttttcagaggggattattgtagaagtcta
actggaaaacccaaacttttcattattcaggcctgccgaggtacagagctagactgtgga
attgagaccgacagcgttgaggatgacatggcgtgtcagaaaataccagttgaggcagat
ttcttgtatgcatactctacagcacctggttactattcgtggcgaaattcaaaggatgga
tcctggttcatccaggcgctttgcgctatgctgaaacagcacgctcagaagcttgagctt
atgcacattcttactcgggttaacagaaaggtagcaacagaatttgagtctttttctttt
gactctacttttcatgcaaagaaacagattccttgcattgtgtctatgctcacaaaagaa
ctgtatttttgtcactaa

DBGET integrated database retrieval system