KEGG   Hipposideros armiger (great roundleaf bat): 109395763
Entry
109395763         CDS       T04661                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai04062  Chemokine signaling pathway
hai04066  HIF-1 signaling pathway
hai04068  FoxO signaling pathway
hai04217  Necroptosis
hai04550  Signaling pathways regulating pluripotency of stem cells
hai04630  JAK-STAT signaling pathway
hai04659  Th17 cell differentiation
hai04917  Prolactin signaling pathway
hai04920  Adipocytokine signaling pathway
hai04931  Insulin resistance
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai04935  Growth hormone synthesis, secretion and action
hai05145  Toxoplasmosis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05169  Epstein-Barr virus infection
hai05200  Pathways in cancer
hai05203  Viral carcinogenesis
hai05205  Proteoglycans in cancer
hai05206  MicroRNAs in cancer
hai05212  Pancreatic cancer
hai05221  Acute myeloid leukemia
hai05223  Non-small cell lung cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hai05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109395763 (STAT3)
   04066 HIF-1 signaling pathway
    109395763 (STAT3)
   04068 FoxO signaling pathway
    109395763 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109395763 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109395763 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    109395763 (STAT3)
   04062 Chemokine signaling pathway
    109395763 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109395763 (STAT3)
   04917 Prolactin signaling pathway
    109395763 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    109395763 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109395763 (STAT3)
   05206 MicroRNAs in cancer
    109395763 (STAT3)
   05205 Proteoglycans in cancer
    109395763 (STAT3)
   05203 Viral carcinogenesis
    109395763 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109395763 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109395763 (STAT3)
   05221 Acute myeloid leukemia
    109395763 (STAT3)
   05223 Non-small cell lung cancer
    109395763 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    109395763 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    109395763 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109395763 (STAT3)
  09172 Infectious disease: viral
   05162 Measles
    109395763 (STAT3)
   05161 Hepatitis B
    109395763 (STAT3)
   05160 Hepatitis C
    109395763 (STAT3)
   05163 Human cytomegalovirus infection
    109395763 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109395763 (STAT3)
   05169 Epstein-Barr virus infection
    109395763 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109395763 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109395763 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hai03000]
    109395763 (STAT3)
Transcription factors [BR:hai03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    109395763 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 E2R135 DUF4795 Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 109395763
NCBI-ProteinID: XP_019522606
LinkDB
Position
Un
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcccaatggaatcagctacagcagctcgacacacggtacctggagcagcttcatcag
ctgtacagtgacagcttcccgatggagctgcggcagtttctggccccttggattgagagt
caagattgggcttatgcggccagcaaagaatcccatgccactttggtgtttcataatctc
ttgggtgagattgatcaacagtacagccgtttcctacaagagtcaaacgttctctatcag
cacaatctgcgaagaatcaagcagttccttcagagcaggtatcttgagaagccaatggag
attgcccgaattgtggcccggtgcctgtgggaagagtcccgcctcctccaaactgcagcc
actgcagcccagcaagggggccaggccaaccaccccacagctgccgtggtgacagagaag
cagcagatgctggagcagcatctacaagatgttcggaagcgcgtacaggatctagaacag
aaaatgaaagtggtagagaatctccaggatgactttgatttcaactataaaaccctcaag
agtcaaggagacatgcaagatctgaatggaaacaaccagtcagtaaccaggcagaagatg
cagcagctggaacagatgttgactgcgctggaccagatgcggcgaagcatcgtgagtgag
ttggcggggcttttgtcagccatggagtacgtgcagaaaactctcacggatgaggagctg
gctgactggaagaggcggcaacagatcgcttgcattggaggccctcccaacatctgccta
gatcgtctagaaaactggataacctcattagcagaatctcaacttcagacccgccaacaa
attaagaaactggaggagttgcagcaaaaggtttcctacaaaggagaccccatcgtacag
caccggccaatgctggaggagagaattgtggagctgtttagaaatttaatgaaaagcgct
tttgtggttgagcggcagccctgcatgcccatgcatcccgaccggccattagtcatcaag
acgggggtccagtttaccactaaagtcagattgctcgtcaaattccccgagttaaattat
cagcttaaaattaaagtgtgcattgacaaagactccggggacgttgcagctctcagagga
tcccggaaattcaacattctgggcacaaacacaaaagtgatgaacatggaagaatccaac
aacggcagcctctctgcagaattcaaacacttgaccctgagagaacaaagatgtggtaac
gggggccgagccaactgtgacgcctccctgattgtgaccgaggagctgcacctgatcacc
tttgagactgaggtgtatcaccaaggcctcaagattgacttagagacccactccttgcca
gtcgtggtgatctccaacatctgtcagatgcccaacgcctgggcgtccatcctgtggtat
aacatgctgaccaacaaccccaagaatgtgaacttcttcaccaagcccccaattggaacc
tgggatcaagtggccgaggtgctgagctggcagttctcctccaccacgaagcgagggctg
agcatcgagcaattgactacgctggcagagaaactcctaggacctggtgtgaactattca
gggtgtcagatcacatgggctaaattttgcaaagaaaacatggctggcaagggcttctcc
ttctgggtctggctggacaatatcattgacctcgtgaaaaagtacatcctggccctttgg
aatgaggggtacataatgggctttatcagtaaggagcgggagagggccatcttgagcacc
aagcccccaggcaccttcctgctaagattcagtgaaagcagcaaagaaggaggcgtcacc
ttcacttgggtggagaaggacatcagcggtaagacccagatccagtcggtggaaccgtat
accaagcagcagctgaacaacatgtcattcgcggaaatcatcatgggctataagatcatg
gatgccaccaatatcctagtgtctccgctggtctatctctaccccgacattcctaaggag
gaggcgttcggaaagtattgtcggccggagagccaggagcacccggaggctgacccaggt
agtgccgccccctacctgaagaccaagtttatctgtgtgacaccaacgacctgcagcaat
accattgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataat
ggtgaaggtgctgaaccctcagcaggagggcagtttgagtccctcacattcgacatggag
ctgacctcggagtgtgctacctcccccatgtga

DBGET integrated database retrieval system