KEGG   Hipposideros armiger (great roundleaf bat): 109395856
Entry
109395856         CDS       T04661                                 

Gene name
TLR3
Definition
(RefSeq) toll like receptor 3
  KO
K05401  toll-like receptor 3
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04217  Necroptosis
hai04620  Toll-like receptor signaling pathway
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109395856 (TLR3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109395856 (TLR3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    109395856 (TLR3)
   05161 Hepatitis B
    109395856 (TLR3)
   05160 Hepatitis C
    109395856 (TLR3)
   05168 Herpes simplex virus 1 infection
    109395856 (TLR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109395856 (TLR3)
   05165 Human papillomavirus infection
    109395856 (TLR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hai04054]
    109395856 (TLR3)
   04090 CD molecules [BR:hai04090]
    109395856 (TLR3)
Pattern recognition receptors [BR:hai04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   109395856 (TLR3)
CD molecules [BR:hai04090]
 Proteins
  109395856 (TLR3)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 Tlr3_TMD TIR LRR_1 LRR_9 TIR_2 LRR_6 LRRNT
Other DBs
NCBI-GeneID: 109395856
NCBI-ProteinID: XP_019522773
LinkDB
Position
Un
AA seq 904 aa
MSRSLFYHISSVLVLLPCWMLCTSSTNKCAVRHEVADCSHRKLTQIPDDLPANITVLNLT
HNQLRKLPPANFTRYSQITILDGGFNSISKLEPELCQNLPLLEILNLEHNELSQLSDKTF
VFCMNLSELHLMSNSIQKIQNNPFKNLKNLIILDLAHNGLSSSKLGTQLQLEKLQELRLS
NNKIHVLRREDLDFLGNSSLQKLELSSNQIKEFSPGCFHAIGKLFHLSLNNAQLGPNLTE
KLCLELSNTSIQSLSLSNIQLYGTNNMTFLGLKQTNLTTLDLSYNSINVIGNNSFGWLPH
LEYFFLEYNNIDHLFSHSFYGLFNVRYLNLRSFTKQSISLSSVPKIDDFSFQWLKCLEYL
NMDDNKFPDLKSNMFTGLIKLKYLSLSNSFTNLHTLTNETFVSLAHSPLLILNLTKNKIS
KIESGAFSCFGHLKILDLGLNEIGQELTGEEWRGLENITEIYLSYNKYLQLTSNSFALVP
SLQQLMLRRVALKNVDISPSPFHPLRNLTILDLSNNNIANINDELLEGLEKLEILDLQHN
NLARLWKHANPGGPVHFLKGLSHLHILNLESNGFDEIPAEIFKDLLELKRIDLGLNNLNI
LPPSVFDNQVSLKSLSLQKNLITSVEKNVFGPAFKNLSSLDMRFNPFDCTCESIAWFVSW
INSTHTNISELSSHYLCNTPPQYHGLPVMLFDISPCKDSAPFELLFMINTSILLIFIFIV
LLIHFEGWRISFYWNVSVHRVLGFKEIDRQPEQFEYAAYIIHAYKDRDWVWEHFCPMEEK
DQTLKFCLEERDFQAGVLELEAIVNSIKRSRKIIFVITQHLLKDPLCKRFKVHHAVQQAI
EQNLDSIILIFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERINAFHHKLQVALGSR
NAVH
NT seq 2715 nt   +upstreamnt  +downstreamnt
atgagtcggagtctgttttatcatatctcctccgttttggtactgttgccctgttggatg
ttgtgtacatcttctaccaacaaatgtgccgtgaggcatgaagtagctgactgcagtcat
cggaagttgactcaaatacctgatgacctaccagcaaacataacagtgttgaatcttacc
cataatcaactcagaaaattaccacctgccaattttacaagatacagccaaattactatc
ttggatggaggatttaactccatttcaaaactggagccagaattgtgccaaaatctccct
ttgttggaaattttgaacctcgaacacaatgagctatctcaactttctgataaaaccttt
gtcttttgtatgaatttgtctgaactccatctaatgtccaactcaatccagaaaattcaa
aataatccctttaaaaacctgaagaatttaatcatattagacctagctcacaatggtttg
tcatctagtaaattaggaactcagctccaactggaaaagctccaagaacttcgattatca
aataataaaattcatgtactaagacgtgaagaccttgatttccttggcaattcttcttta
caaaaattagagttgtcctcaaatcaaattaaagagttctctccaggatgttttcatgca
attggaaaattatttcatctctctctaaataatgcccagctgggccccaatctcacagag
aagctttgtttggaattatccaacacaagcattcagagtctatccctgagcaacatccag
ctatacggaacaaacaatatgacttttcttggactaaagcagacaaatctcaccacgctc
gatctttcatataacagcataaatgtgattggtaataattcctttggttggcttccacat
ttagagtatttcttcctggagtacaataatatagaccatttgttttctcactccttttat
gggcttttcaatgtgagatacctgaatttgagatcttttactaaacaaagcatttccctt
tcttcggttcccaagattgatgacttttcctttcaatggctaaaatgtttggaatatctt
aacatggatgataacaagtttccagacttaaaaagcaatatgttcacaggtctaataaag
ctgaaatacttaagtctatccaactccttcacaaatttgcatactttaacaaatgaaaca
ttcgtgtcacttgctcattctcctttacttatactcaacctaacgaaaaataaaatatca
aaaatagagagtggagctttttcttgctttggccatcttaagatacttgaccttggactc
aatgaaattgggcaagaactcacaggtgaagaatggagaggtctagaaaacatcactgaa
atttacctttcctacaacaaatacctacaactgactagcaattcttttgccttggttcca
agccttcaacaactgatgctccgaagggtggcccttaaaaatgtggatatttccccttca
ccttttcaccctcttcgtaacttaaccattctggatctaagcaacaacaatatagccaac
ataaatgatgaactgttggagggtcttgagaaactagaaatcctggatttgcagcataac
aatttagctcggctctggaagcatgcaaaccctggtggtcctgttcattttctaaagggt
ctttctcacctccacatccttaacttagagtctaatggctttgatgagatccctgcagag
atcttcaaggacttacttgaattaaagagaatcgatttaggattgaataatttaaacata
cttcccccatctgtctttgataatcaggtatctctaaagtcactgagccttcagaagaat
ctcataacatcggttgagaagaatgtttttgggccagctttcaagaacctgagtagttta
gatatgcgctttaatccatttgactgtacatgtgaaagcattgcttggtttgttagctgg
attaacagtacccataccaacatctctgagctatcaagccactacctctgtaatactccg
cctcaatatcatggtttaccagtgatgctttttgatatatcaccctgcaaagacagtgcc
ccctttgagctgcttttcatgataaataccagtatcctactgatttttatttttattgta
ctgctcatccattttgaaggctggaggatatctttttattggaatgtttcagtgcatcga
gttcttggtttcaaagaaatagacagacagccagagcaatttgaatatgccgcatatata
attcatgcctataaagatagggattgggtctgggagcacttctgcccaatggaagaaaaa
gatcaaactctcaaattttgtctagaagaaagggactttcaggcaggtgtccttgaactt
gaagcaattgttaatagcatcaaaaggagcagaaaaattatttttgttataacacagcat
cttttaaaagatccattatgcaaaagattcaaggtgcaccatgcagttcagcaagctatt
gaacaaaacctagattccattattttgatctttcttgaggagattccagattataaactg
aatcatgcactctgcttacgaagaggaatgtttaaatctcattgcatcttgaactggcca
gttcagaaagaacggataaatgcctttcatcataaattgcaagtagcacttggatccaga
aatgcagtacattaa

DBGET integrated database retrieval system