KEGG   Hipposideros armiger (great roundleaf bat): 109395924
Entry
109395924         CDS       T04661                                 

Gene name
IL2
Definition
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04060  Cytokine-cytokine receptor interaction
hai04061  Viral protein interaction with cytokine and cytokine receptor
hai04151  PI3K-Akt signaling pathway
hai04625  C-type lectin receptor signaling pathway
hai04630  JAK-STAT signaling pathway
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04660  T cell receptor signaling pathway
hai04672  Intestinal immune network for IgA production
hai04940  Type I diabetes mellitus
hai05135  Yersinia infection
hai05142  Chagas disease
hai05162  Measles
hai05166  Human T-cell leukemia virus 1 infection
hai05200  Pathways in cancer
hai05320  Autoimmune thyroid disease
hai05321  Inflammatory bowel disease
hai05330  Allograft rejection
hai05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109395924 (IL2)
   04151 PI3K-Akt signaling pathway
    109395924 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109395924 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109395924 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109395924 (IL2)
   04660 T cell receptor signaling pathway
    109395924 (IL2)
   04658 Th1 and Th2 cell differentiation
    109395924 (IL2)
   04659 Th17 cell differentiation
    109395924 (IL2)
   04672 Intestinal immune network for IgA production
    109395924 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109395924 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109395924 (IL2)
   05321 Inflammatory bowel disease
    109395924 (IL2)
   05330 Allograft rejection
    109395924 (IL2)
   05332 Graft-versus-host disease
    109395924 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109395924 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109395924 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109395924 (IL2)
   05162 Measles
    109395924 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109395924 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hai04052]
    109395924 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:hai00536]
    109395924 (IL2)
Cytokines and growth factors [BR:hai04052]
 Cytokines
  Interleukins
   109395924 (IL2)
Glycosaminoglycan binding proteins [BR:hai00536]
 Heparan sulfate / Haparin
  Cytokines
   109395924 (IL2)
SSDB
Motif
Pfam: IL2 Baculo_PEP_C
Other DBs
NCBI-GeneID: 109395924
NCBI-ProteinID: XP_019522927
LinkDB
Position
Un
AA seq 154 aa
MYKMHFLSCIALTLALVADGAPISSSRKETQHQLDGLLTDLQKLLKGVNNYKDPERFMML
TFKFNMPKKVTELQHLQCLAEELRPLKDALLLVHSKNFPFSEIKDSMNNINVTVQVLKGP
ETRVPSECDDETANIVEFLNQWITFCQNIFSTLT
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtacaagatgcatttcttgtcttgcattgcactaactcttgcactcgtcgcagacggg
gcacctatttcaagctctaggaaggaaacacagcaccagctggatggtttactgacggat
ttacagaagcttttgaagggagttaataattacaaggaccccgaacgcttcatgatgctc
acatttaaatttaacatgcccaagaaggtcacagaacttcaacatctgcagtgcctcgca
gaagaactcagacctctgaaggacgcgttacttttagttcacagcaaaaactttcccttc
agcgagatcaaggactcaatgaacaatatcaatgtaacagttcaggtactaaagggacct
gaaacaagagtcccatctgaatgtgatgatgagacagcaaacattgtagaatttctgaac
caatggattaccttttgtcaaaacatcttctcaacactgacttaa

DBGET integrated database retrieval system