KEGG   Hipposideros armiger (great roundleaf bat): 109395991
Entry
109395991         CDS       T04661                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01522  Endocrine resistance
hai01524  Platinum drug resistance
hai04012  ErbB signaling pathway
hai04066  HIF-1 signaling pathway
hai04068  FoxO signaling pathway
hai04110  Cell cycle
hai04115  p53 signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04218  Cellular senescence
hai04630  JAK-STAT signaling pathway
hai04921  Oxytocin signaling pathway
hai04928  Parathyroid hormone synthesis, secretion and action
hai04934  Cushing syndrome
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05163  Human cytomegalovirus infection
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05169  Epstein-Barr virus infection
hai05200  Pathways in cancer
hai05202  Transcriptional misregulation in cancer
hai05203  Viral carcinogenesis
hai05205  Proteoglycans in cancer
hai05206  MicroRNAs in cancer
hai05210  Colorectal cancer
hai05211  Renal cell carcinoma
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05216  Thyroid cancer
hai05217  Basal cell carcinoma
hai05218  Melanoma
hai05219  Bladder cancer
hai05220  Chronic myeloid leukemia
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109395991 (CDKN1A)
   04630 JAK-STAT signaling pathway
    109395991 (CDKN1A)
   04066 HIF-1 signaling pathway
    109395991 (CDKN1A)
   04068 FoxO signaling pathway
    109395991 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    109395991 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109395991 (CDKN1A)
   04115 p53 signaling pathway
    109395991 (CDKN1A)
   04218 Cellular senescence
    109395991 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    109395991 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    109395991 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109395991 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    109395991 (CDKN1A)
   05206 MicroRNAs in cancer
    109395991 (CDKN1A)
   05205 Proteoglycans in cancer
    109395991 (CDKN1A)
   05203 Viral carcinogenesis
    109395991 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109395991 (CDKN1A)
   05212 Pancreatic cancer
    109395991 (CDKN1A)
   05225 Hepatocellular carcinoma
    109395991 (CDKN1A)
   05226 Gastric cancer
    109395991 (CDKN1A)
   05214 Glioma
    109395991 (CDKN1A)
   05216 Thyroid cancer
    109395991 (CDKN1A)
   05220 Chronic myeloid leukemia
    109395991 (CDKN1A)
   05217 Basal cell carcinoma
    109395991 (CDKN1A)
   05218 Melanoma
    109395991 (CDKN1A)
   05211 Renal cell carcinoma
    109395991 (CDKN1A)
   05219 Bladder cancer
    109395991 (CDKN1A)
   05215 Prostate cancer
    109395991 (CDKN1A)
   05213 Endometrial cancer
    109395991 (CDKN1A)
   05224 Breast cancer
    109395991 (CDKN1A)
   05222 Small cell lung cancer
    109395991 (CDKN1A)
   05223 Non-small cell lung cancer
    109395991 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109395991 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109395991 (CDKN1A)
   05161 Hepatitis B
    109395991 (CDKN1A)
   05160 Hepatitis C
    109395991 (CDKN1A)
   05163 Human cytomegalovirus infection
    109395991 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109395991 (CDKN1A)
   05169 Epstein-Barr virus infection
    109395991 (CDKN1A)
   05165 Human papillomavirus infection
    109395991 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109395991 (CDKN1A)
   01522 Endocrine resistance
    109395991 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 109395991
NCBI-ProteinID: XP_019523035
LinkDB
Position
Un
AA seq 164 aa
MSEPSRDAHPIPRGSKACRRLFGPVDSEQLSRDCDALMASCVQEACERWNFDFVTETPLK
GDFAWERVWGLGLPKLYLSSGSRGSRDDLGGGKRPSSSPALLQGTAQEDHVDLSLSCALV
PRSPERPEESPGGPSTSQGRKRRQTSMTDFYHSKRRLVFSKRRP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcggagccgtcccgggacgcccatccgatcccccgtggcagcaaggcctgccgccgc
ctcttcggcccagtggacagtgagcagctgagccgagactgcgatgcattaatggccagc
tgtgtccaggaggcctgcgagcgatggaacttcgactttgtcactgagacacctctgaag
ggcgactttgcctgggagcgtgtgtggggcctgggtctgcccaagctctacctgagctca
gggtcccgggggtcccgggacgacctgggaggaggcaagcggcccagcagctcgcctgct
ctgctgcaggggacagctcaggaggaccacgtggacctgtcactgtcatgcgccctggta
cctcgctcccctgaacggcctgaggagtctccaggtgggcctagcacctctcagggccga
aaacggcggcagaccagcatgacagatttctatcactccaaacgccggctggtcttctcc
aagaggaggccctaa

DBGET integrated database retrieval system