KEGG   Hipposideros armiger (great roundleaf bat): 109396273Help
Entry
109396273         CDS       T04661                                 

Gene name
PML
Definition
(RefSeq) promyelocytic leukemia
  KO
K10054  probable transcription factor PML
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04120  Ubiquitin mediated proteolysis
hai04144  Endocytosis
hai05164  Influenza A
hai05168  Herpes simplex virus 1 infection
hai05200  Pathways in cancer
hai05202  Transcriptional misregulation in cancer
hai05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:hai00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109396273 (PML)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109396273 (PML)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109396273 (PML)
   05202 Transcriptional misregulation in cancer
    109396273 (PML)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    109396273 (PML)
  09172 Infectious disease: viral
   05164 Influenza A
    109396273 (PML)
   05168 Herpes simplex virus 1 infection
    109396273 (PML)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hai04121]
    109396273 (PML)
Ubiquitin system [BR:hai04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    109396273 (PML)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3583 zf-B_box ATPase APG6_N DUF763 Prok-RING_4
Motif
Other DBs
NCBI-GeneID: 109396273
NCBI-ProteinID: XP_019523497
LinkDB All DBs
Position
Un
AA seq 882 aa AA seqDB search
MQQEPAPARSSGSQQDSAPPQALTMPPPESLSEDHQSSPGHSPTEQATEEEFQFLRCQHC
RAEAKCPKLLPCLHTLCSGCLEVPRMRCPICQAPPPTGADAPICQAPQPAGADAQALDNV
FFESLQRRLSVYRQIANSQAVCTRCQELADFWCFECEQLLCAKCFEAHQWFLKHEARPLA
ELRNQSVCEFLDGTRKSNNIFCSNPNHRTPMLTSIYCRGCSKPLCCTCALLDNGHSDKCD
ISEEIQKRQEELDTMTQALQEQDRTFSAAQAQMNSAGSQLARVRTDMEELIRERVRHAVE
RVREQERLLLEAVKTRYQSDSQEIRDQLGHLESVLQRIRIGSTLVQRMKRFASDQEVLDM
HDFLREALSRLHQEKPQDLQAAVRTDGFEEFRVRLQDLVSSITQGTDAGPLRRSIPEAAS
SPRDPPAVDLPERAQMAQPQTPRLAETQPVAVVQSVPGAHPMPMYAYSIKDPSHREEFSN
TTTTQKRKSCQTESPRKMIKMETEEEKEARLAQSSPEQPRPSTSKAVSPPHLDEPTSPKT
PTVGNEAVLLNSSHTAGDSGEAEERVVVISSSEDSDVENSSFRELDDNSSESSDLQLEGS
NSLRVLDDSLANSQAENRPLVFFDLKIDNETQKISQLAAVNQESKFRVLIQPEAFNVYSK
AVSLEVGLQHFLRFLNSMCHPILACYKLWGPSLPSFFRALEDMNRLWEFKEAISGFLAIL
PLIQERVPQASSFKLRSLAQTYLARNMSERSALAAVLTMRDLCRLLEVSPGQELAQHVYS
FSNLQCFTSLQPLVQAAVLPRASARLLALHNVTYTELLTAHRWDPQRGLKKYSRYLQSTT
SPSAQSALNLQALSTYFKDLLERPALAQAEGTSTPLAGHSLA
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaggagcctgcacccgcccgatcttcgggatcccagcaggactccgcaccgccc
caagcgctcaccatgcctcccccggagtccctctccgaagaccaccagtccagccccggc
cacagccccacagagcaagctacggaggaggagttccagttcctgcgctgccagcactgc
cgtgcagaagccaagtgccctaagctgctgccttgtctgcacacgctgtgctcaggatgc
ctggaggtgccccgcatgcggtgccctatctgccaggcgcccccgcccacaggagctgac
gcgcctatctgccaggcaccccagcccgcaggcgctgacgcgcaggctctggataacgtc
ttcttcgaaagtctgcagcggcgcttgtcggtataccggcagatcgctaactcgcaggcg
gtttgcactcgctgccaagagctggccgacttctggtgcttcgagtgcgagcagctcctc
tgtgcaaagtgcttcgaggcgcaccagtggttcctcaagcacgaggcccggcccctggca
gagctccgcaaccagtcggtgtgcgagttcctggacggcacgcgcaagtccaacaacatc
ttctgctccaaccccaaccaccgtacccctatgctgaccagcatctactgccgaggctgc
tccaagccactgtgctgcacgtgcgcgcttctggataatggccacagtgacaagtgcgac
atcagcgaggagatccagaagcgacaggaggagctggacaccatgacgcaggcgctacag
gagcaggaccgcaccttcagtgcggcgcaggcgcagatgaactccgccggcagccagctg
gcgcgcgtgcgcacagacatggaggaactgatccgcgagcgtgtgcgtcacgcagtagag
cgcgtgcgggagcaggagcgcttgctgctggaggcggtaaagacccggtaccagagcgac
tcccaggagatccgggaccagttgggccacctggagtctgtgctgcagcgcatccgcatc
ggcagcactctggtgcagagaatgaagcgcttcgcctcagaccaggaggtgctggacatg
cacgacttcctgcgggaggcgctcagccgcctgcaccaggagaaaccccaagacctgcaa
gctgccgtgcgcaccgatggcttcgaggaattcagggtgcgcctgcaggacctcgtctct
agtatcacccaggggacagatgcaggtccactgaggagatccatcccagaggctgccagc
agtcccagggaccctcctgccgttgacctgccagagagggcacagatggctcagccacag
accccgaggctggctgagactcagcctgtggccgtggtacagtcagtgcctggggcacac
cctatgccgatgtacgcttactccatcaaagacccctcccacagagaggagttctccaac
acaaccacaacacaaaagaggaagtcctgccagaccgagagcccaaggaagatgatcaag
atggagactgaggaggagaaggaggccaggttggcccagagctcccctgagcagcccagg
cccagcacctccaaggcagtctcgccaccccacctggacgagcccaccagccccaagacc
cccactgtaggaaatgaggccgtactgctcaacagcagccatacagccggcgactctggg
gaggcagaggagcgcgttgtggtgatcagcagctcagaagactcagatgtggaaaattcg
tccttccgagagttggatgacaacagcagcgagtccagtgaccttcagctggagggctcc
aactccctcagggtcctggacgacagcctcgccaactcccaagcggaaaacaggcccttg
gttttctttgacctcaagattgacaatgaaacccagaagattagccagctggctgccgtg
aaccaggaaagcaagttccgtgtgctcatccaaccggaggccttcaacgtctactccaag
gctgtgtccctggaggtggggctgcagcatttccttcgcttcctgaactccatgtgccac
cccatcttggcttgctataagctgtgggggcccagtctccccagcttcttccgggctctg
gaggacatgaacaggctgtgggagttcaaggaggccatctcaggcttcctggccatcctg
cccctcatccaggagcgtgtgcctcaggccagcagcttcaaactcagaagtctggcccag
acctacctggcgaggaacatgagcgagcgcagtgccctggccgccgtgctgaccatgcgt
gacctgtgccgcctcctcgaggtctccccgggccaggagctggcccagcacgtctattcc
ttcagcaacctgcagtgcttcacatccctgcagcccctggtgcaggcggccgtcctgccc
cgggcctcagcccgcctcttggccctccacaatgtgacctacacggagctgctgactgca
caccgctgggacccacagaggggcttgaagaagtatagccgctacctgcagtccaccaca
tcaccctctgcccagtctgctctcaacctgcaggccctaagcacctacttcaaagacctg
ttagagaggccggccttggcacaggcagaaggcacttctacccctcttgctggccacagc
ttggcctaa

DBGET integrated database retrieval system