KEGG   Hipposideros armiger (great roundleaf bat): 109396418
Entry
109396418         CDS       T04661                                 

Gene name
IFNB1
Definition
(RefSeq) interferon beta 1
  KO
K05415  interferon beta
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04060  Cytokine-cytokine receptor interaction
hai04151  PI3K-Akt signaling pathway
hai04217  Necroptosis
hai04380  Osteoclast differentiation
hai04620  Toll-like receptor signaling pathway
hai04621  NOD-like receptor signaling pathway
hai04622  RIG-I-like receptor signaling pathway
hai04623  Cytosolic DNA-sensing pathway
hai04630  JAK-STAT signaling pathway
hai04650  Natural killer cell mediated cytotoxicity
hai04668  TNF signaling pathway
hai05135  Yersinia infection
hai05142  Chagas disease
hai05152  Tuberculosis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109396418 (IFNB1)
   04668 TNF signaling pathway
    109396418 (IFNB1)
   04151 PI3K-Akt signaling pathway
    109396418 (IFNB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109396418 (IFNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109396418 (IFNB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109396418 (IFNB1)
   04621 NOD-like receptor signaling pathway
    109396418 (IFNB1)
   04622 RIG-I-like receptor signaling pathway
    109396418 (IFNB1)
   04623 Cytosolic DNA-sensing pathway
    109396418 (IFNB1)
   04650 Natural killer cell mediated cytotoxicity
    109396418 (IFNB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109396418 (IFNB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109396418 (IFNB1)
   05152 Tuberculosis
    109396418 (IFNB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109396418 (IFNB1)
   05162 Measles
    109396418 (IFNB1)
   05164 Influenza A
    109396418 (IFNB1)
   05161 Hepatitis B
    109396418 (IFNB1)
   05160 Hepatitis C
    109396418 (IFNB1)
   05168 Herpes simplex virus 1 infection
    109396418 (IFNB1)
   05163 Human cytomegalovirus infection
    109396418 (IFNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109396418 (IFNB1)
   05169 Epstein-Barr virus infection
    109396418 (IFNB1)
   05165 Human papillomavirus infection
    109396418 (IFNB1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109396418 (IFNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hai04052]
    109396418 (IFNB1)
Cytokines and growth factors [BR:hai04052]
 Cytokines
  Interferons
   109396418 (IFNB1)
SSDB
Motif
Pfam: Interferon AD AAA_lid_11
Other DBs
NCBI-GeneID: 109396418
NCBI-ProteinID: XP_019523753
LinkDB
Position
Un
AA seq 186 aa
MTNRYILQMALLLCFSTTALSISYNLLRFQQRSCNLACLKLLRQLNGVPQNCLDDRMDFE
IPEEIKQPQQFQKEDAILIIHEMLQQIFDIFRKNFSSTGWNETTIENFYMELSQQTDRLD
TALEEIMEEENLTWRDTTMLHLKNYYSRITRYLKAKLYSNCAWTVVQKEILRNFVFLNRL
TDYLQN
NT seq 561 nt   +upstreamnt  +downstreamnt
atgaccaacaggtacatccttcagatggctctcctgttgtgtttctccaccacagctctt
tccatcagctacaacttacttagatttcaacaaagaagctgcaatttggcctgtctgaag
ctcctgcggcagttgaatggagtccctcaaaattgtctcgacgacaggatggacttcgag
attcctgaggagattaaacaaccacagcagttccagaaggaggatgccattttaatcatc
cacgagatgctccagcagatctttgatattttcagaaaaaatttctctagcactggctgg
aatgagaccaccattgagaacttttacatggaactcagtcagcagactgaccgcctggac
acagccctggaggaaataatggaggaggaaaacctcacctggcgagacacgaccatgctg
cacctaaagaattattactcaaggatcacacggtacttgaaggccaagttgtacagcaac
tgtgcctggacagtagtccaaaaggaaatcctcaggaactttgtcttccttaacagactt
acagactacctccaaaactga

DBGET integrated database retrieval system