KEGG   Halomonas sp. KO116: KO116_00334Help
Entry
KO116_00334       CDS       T03800                                 

Definition
(GenBank) Glutathione S-transferase domain-containing protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hak  Halomonas sp. KO116
Pathway
hak00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:hak00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KO116_00334
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hak02000]
    KO116_00334
Enzymes [BR:hak01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     KO116_00334
Transporters [BR:hak02000]
 Other Transporters
  Pores ion channels [TC:1]
   KO116_00334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AJY48842
UniProt: A0A0D5LY91
LinkDB All DBs
Position
complement(333762..334385)
Genome map
AA seq 207 aa AA seqDB search
MITLYSFPQSRSLRVAWTLEELGLEYQCQHVALDKGEGQTAAHLARHPDGKVPVIEDGDV
HLFESAPICRYLAETYGDGTLLPSDPAARAQVDQWLSFIVTEIEQPLWNQAKHKFALPAD
KRVPAILPVCAWEFQRAVGALERRYNGQKYLVGNTFTLADLFLTHTLSWAASMKHRLPEP
LFAYRERHIKRPAMAKAVAREKAAAEG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgatcacgctatatagcttcccccagtcgcgctcgttaagagtggcgtggacgcttgaa
gagctaggccttgagtaccagtgccagcacgtggccttggataaaggcgagggccaaacg
gccgcgcatttggcacgtcacccggatggcaaggtaccggtcattgaagatggcgatgta
cacctgtttgagtcggcgcctatttgccgctatctggccgagacctatggcgatggcacg
ctgctgcccagcgaccccgcggcccgcgcccaagttgatcaatggctcagctttatcgtg
acggaaattgagcagccgctgtggaatcaggccaagcataagtttgccttgccagcagac
aaacgtgttcctgctattttgccggtttgtgcctgggagtttcagcgtgcagtcggtgcc
ttggagcgccgttataacggtcagaaatatctagtaggtaacacctttaccctagcggat
ctgtttctgacccataccctttcctgggcggccagcatgaagcatcgcttacccgagccg
ctctttgcttaccgcgagcgtcatatcaagcgccccgccatggctaaagccgtcgcgcgt
gagaaagccgccgctgagggttaa

DBGET integrated database retrieval system