KEGG   Halomonas sp. KO116: KO116_00510Help
Entry
KO116_00510       CDS       T03800                                 

Definition
(GenBank) 3-oxoacyl-(acyl-carrier-protein) reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
hak  Halomonas sp. KO116
Pathway
hak00061  Fatty acid biosynthesis
hak00780  Biotin metabolism
hak01100  Metabolic pathways
hak01130  Biosynthesis of antibiotics
hak01212  Fatty acid metabolism
Module
hak_M00083  Fatty acid biosynthesis, elongation
hak_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:hak00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    KO116_00510
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    KO116_00510
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    KO116_00510
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hak01004]
    KO116_00510
Enzymes [BR:hak01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     KO116_00510
Lipid biosynthesis proteins [BR:hak01004]
 Fatty acid synthase
  Component type
   KO116_00510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Nup88
Motif
Other DBs
NCBI-ProteinID: AJY49011
UniProt: A0A0D5LYG8
LinkDB All DBs
Position
518353..519114
Genome map
AA seq 253 aa AA seqDB search
MEVTNKVIAITGGASGLGYAMAQRLGKQGAILALLDRNAVTLDDAVSELTEQGINAHGFP
LDVSDEQSVITAFADIAARLGPVEGCINNAGITDDALLIKAQDGVVTKRMSLAAWKRVID
VNLTGIFLCGREAASHMMESGKGGVIVNISSISRAGNMGQSNYAAAKAGVHALTVTWAKE
LAKYGIRTGSVAPGFIVTPMTAAMRPDMQEKLASGIPLKQFGQADNIAQSVAFIMENDYF
TGRMIECDGGLRM
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcaccaacaaagttatcgcgattaccggcggggcgagcgggcttggttatgcc
atggcccagcgtttaggcaagcaaggggcgatactggccttattagatagaaatgccgtt
acgctggatgatgctgtctccgagctgactgagcaggggatcaatgcccacgggtttcca
ctagacgtatcagacgagcagtccgtcattactgcatttgctgatattgcggctcggtta
gggccggtagaaggatgcattaataacgccggtattactgatgatgccttattaataaaa
gcccaagacggagtggtgaccaagcgtatgtcgctggctgcttggaaacgagtcatcgat
gtcaatttaaccggcatttttctgtgtggacgcgaagctgctagtcacatgatggaatca
ggaaaagggggtgtcatcgtcaacatctcaagtatttcccgcgcgggaaacatgggccaa
agcaactacgcggctgccaaagcgggtgttcatgccctcacggtaacgtgggcaaaagag
ttggcgaaatacgggattcgcaccggtagcgtagcgccagggtttatcgtgacccccatg
acggcggcgatgcgccctgacatgcaagaaaaacttgccagcggtataccgcttaaacaa
tttggccaagcggataatattgcccagagcgtcgcgtttattatggagaacgattatttc
acaggcaggatgattgagtgtgatggtggtttaagaatgtag

DBGET integrated database retrieval system