KEGG   Halomonas sp. KO116: KO116_00584Help
Entry
KO116_00584       CDS       T03800                                 

Definition
(GenBank) protein of unknown function DUF81
  KO
K07090  uncharacterized protein
Organism
hak  Halomonas sp. KO116
Brite
KEGG Orthology (KO) [BR:hak00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    KO116_00584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AJY49085
UniProt: A0A0D5LYS6
LinkDB All DBs
Position
complement(612262..613050)
Genome map
AA seq 262 aa AA seqDB search
MRGFFVVHFFEYLEATMLPDYTVIAWLLIVFSVYLTGVSKGGFAGGFGTLSVPLMALAIS
PTQAAGLLLPLLLVMDVFAVKAWWGKQSNAEVWRFVPGLFIGVAVGTVLFGSLSEQGVRL
ALGILSVVFAAYMLLKPVAKKPISSRWALPAASVCGFTSFIAHAGAPPMNMYLMPRKLSK
ETFIATCTITYAVVNTIKLGPYVWLGEVNMTSAWASLLLVPVAWIGVRNGLWLQSRVNEK
LFYRLVILAMFLVGINLVWQAL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgcggggcttttttgtggttcacttttttgaatatcttgaggcgaccatgctccccgac
tataccgtgattgcctggctgttgatcgtgttttccgtttatctaaccggcgtatcaaaa
ggcggctttgcaggtggtttcggaacactctcggtgccgttaatggcactagcgattagc
ccaacccaagcggcagggctactgcttccgctgctgctggtgatggacgtgtttgcggtg
aaggcgtggtggggcaagcagtcgaatgcggaagtgtggcgctttgtgccaggcttgttc
atcggcgtggcggtgggaacagtgctatttggcagcttgagcgagcaaggcgtgcgcttg
gcattgggaattctatccgtcgtgttcgccgcttatatgctgctaaaacctgtcgctaaa
aagccgatttccagccgctgggcgctgcctgcggcaagcgtttgtgggtttaccagtttc
attgcccacgcgggcgcgccgccaatgaacatgtatctaatgccgcgcaagctctccaaa
gagacctttattgccacctgcacgatcacttacgcagtagtcaacaccatcaaactgggc
ccatatgtgtggcttggcgaagttaatatgaccagtgcctgggcctcgctgctgctagtg
ccagtggcctggatcggcgtgcgtaacggcctttggctgcaaagccgagtcaatgaaaag
ctgttttaccgcttagttatcctggccatgttcttggtgggtatcaacttggtttggcag
gcactctaa

DBGET integrated database retrieval system