KEGG   Halomonas sp. KO116: KO116_00954Help
Entry
KO116_00954       CDS       T03800                                 

Definition
(GenBank) Malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
hak  Halomonas sp. KO116
Pathway
hak00020  Citrate cycle (TCA cycle)
hak00270  Cysteine and methionine metabolism
hak00620  Pyruvate metabolism
hak00630  Glyoxylate and dicarboxylate metabolism
hak00680  Methane metabolism
hak01100  Metabolic pathways
hak01110  Biosynthesis of secondary metabolites
hak01120  Microbial metabolism in diverse environments
hak01130  Biosynthesis of antibiotics
hak01200  Carbon metabolism
Module
hak_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hak_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hak_M00012  Glyoxylate cycle
hak_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hak00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KO116_00954
   00620 Pyruvate metabolism
    KO116_00954
   00630 Glyoxylate and dicarboxylate metabolism
    KO116_00954
  Energy metabolism
   00680 Methane metabolism
    KO116_00954
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    KO116_00954
Enzymes [BR:hak01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     KO116_00954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AJY49451
UniProt: A0A0D5LZU6
LinkDB All DBs
Position
1007685..1008659
Genome map
AA seq 324 aa AA seqDB search
MKDPVRIAITGGAGQISYSLIFRIAAGDMLGPDQPVILQLLEIPQAMDALNGVVMEVNDC
AFPLVQDIVATDDPNVAFKDADFALLVGARPRGPGMERKDLLEANAAIFSVQGKALNDHA
SRDVKVLVVGNPANTNALIASCNAPDLDAGQFTAMTRLDHNRALTQLAQKTGKHVTDVEN
MIIWGNHSATQYPDLAQCKVDGKAAFDLVERDWYENDFIPTVQQRGAAIIKARGASSAAS
AASSAIDHMHDWALGSKGIVSMAIPSDGSYGIDEGIIYSYPVRCQGGKYEIVQGFEIDEF
SQEKMKATEKELREERAAVEHLLG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatccagtacgtattgcgattaccggcggcgccggtcagatcagctattctctt
attttccgcatcgccgctggcgacatgttggggccggatcagcctgtcattctccagctt
ctggaaattccccaggcaatggacgctctgaacggcgtggtaatggaagtcaatgactgt
gccttcccgctagtacaagacatcgttgctaccgacgatccgaatgtcgcgttcaaagac
gccgacttcgccctgctggttggcgcacgtccgcgtggtccgggcatggagcgtaaagac
ctgctggaagccaacgccgcgatcttctccgtacaaggtaaagcgctgaacgaccacgct
agccgtgacgtgaaagtgctggttgtgggtaacccggctaacaccaacgcgctgatcgct
tcctgcaacgcgccggatctggacgctggtcagttcaccgccatgacgcgcctggaccac
aaccgcgccctaacccagctggcacagaaaaccggcaagcacgtcactgacgttgaaaac
atgatcatctggggcaaccatagtgccacccagtatccggatctggcccagtgcaaagtc
gacggcaaagcagcgttcgatctggttgagcgtgactggtacgaaaacgatttcatcccc
accgtgcagcagcgcggcgcggcgatcatcaaagcacgtggcgcttcctctgccgcttct
gctgcctcttccgccatcgaccatatgcacgactgggcgctgggctccaaaggtatcgtc
agcatggcgattccctctgacggcagctacggcatcgacgaaggcatcatctactcctac
ccagtgcgttgccagggtggcaagtatgaaattgttcaaggcttcgaaattgacgagttc
agccaagagaagatgaaagccaccgagaaagaactgcgcgaagagcgtgcagccgtcgag
cacctgctcggctaa

DBGET integrated database retrieval system