KEGG   Halomonas sp. KO116: KO116_01692Help
Entry
KO116_01692       CDS       T03800                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hak  Halomonas sp. KO116
Brite
KEGG Orthology (KO) [BR:hak00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    KO116_01692
Enzymes [BR:hak01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     KO116_01692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored HI0933_like Glutaredoxin DAO K_oxygenase Thi4 FAD_binding_3 FMO-like DUF3467 NAD_binding_8 YojJ
Motif
Other DBs
NCBI-ProteinID: AJY50177
UniProt: A0A0D5M241
LinkDB All DBs
Position
complement(1814453..1816009)
Genome map
AA seq 518 aa AA seqDB search
MLDANLKSQLKAYLEKVTQPFEIVASLDDGAKSQELLGLLEDISSLSDKITLHSDGQDAR
TPSFALNRPGEETGVVFAGIPMGHEFTSLVLALLHVGGHPPKTSDELLDQVRALDGEMLF
ETYYSLSCQNCPDVVQALNLMAIFNPNVRHVAIDGALFQDEVESREIMSVPSVYLNGKPF
DQGRMTLEQILAKVDTGAAERDAKKLSEKAAFDTLVIGGGPAGAAAAIYSARKGINTGVA
AERFGGQVADTMGIENFISVSHTEGPKMVSALEEHVKDYEVDVMNLQLATSFKAAETEGG
LHEVSFESGAKLKSKTLVLATGARWREMNVPGEQQYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVGHVTLVEFMGEMRADAVLQKKLKSLPNVDIILNAQSTEVTGDG
SRVNGLNYKDRTTDESKSIALEGIFVQIGLVPNTEWLKGSPIEMTPRGEIIVDAHGMTSV
PGVFAAGDVTTVPYKQIIIAMGEGAKASLGAFDYLIRN
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaatttaaaatcccagttaaaagcgtatctggaaaaagtgactcagccg
ttcgagatcgttgcgtccctcgatgacggtgccaagtcacaagaattgcttggtctgttg
gaagatatcagcagcctgagcgacaagattaccttgcacagcgatggtcaggatgcacgt
acgccatcgtttgcgctcaaccgccccggtgaagagactggcgtggtgtttgcaggcatt
cctatgggccacgagttcacctcgttagtgcttgccctgctgcacgttggcggtcatccg
cctaagacgtctgacgaattgcttgatcaggttcgagcattagatggcgagatgcttttc
gagacctattactcgctgtcttgccagaactgcccggacgtggttcaggcactcaatttg
atggccatcttcaacccgaacgtgcgccacgtcgctattgacggcgcgctgtttcaggat
gaagtcgagtctagggaaatcatgtcggtgccgagcgtctatttgaacggtaaaccgttc
gaccagggccgcatgacgcttgaacagattcttgccaaggttgataccggtgccgccgaa
cgcgatgccaaaaagctgagcgaaaaagccgctttcgatacgcttgtcattggtggtggc
ccggcaggtgctgcggcggctatctactcggcgcgcaaaggcatcaataccggcgttgcc
gctgagcgcttcggtggtcaggtggcggacaccatgggcattgaaaacttcatttcggtg
tcacacaccgaaggcccgaaaatggtcagcgcgctagaagagcatgtcaaagattacgaa
gttgacgtcatgaacctgcagcttgctacttcctttaaagctgccgagacagaaggcggc
cttcacgaagtatcgtttgagtccggcgctaagctgaagagcaagacgctagtactggcg
acaggcgcccgctggcgtgagatgaacgtgcccggcgagcagcagtatcgcaacaaaggt
gttgcctactgccctcactgtgacggtccgctgttcaaaggcaagcgggtagcggttata
gggggtggtaactcgggtgttgaagcggcgattgacttagcgggcattgtcggccacgtc
acgctggttgagtttatgggcgagatgcgcgctgatgcggtgctgcagaaaaagctcaag
agcctgcctaacgttgatatcattctcaacgcccaatcgaccgaagtcaccggtgacggc
agccgtgtcaatggcttgaactataaagaccgtacgactgatgagagcaaatccatcgcg
ttagaaggtatttttgttcagattggtctggtacctaacaccgagtggttgaaaggctca
ccgatcgaaatgacgccgcgtggtgaaatcattgtcgatgcccatggcatgacatccgtg
cccggcgtatttgccgcaggcgatgtgaccaccgtgccctacaagcagatcattatcgcc
atgggcgaaggtgctaaagcatcgctcggcgcttttgactacttgattcgtaactga

DBGET integrated database retrieval system