KEGG   Halomonas sp. KO116: KO116_01770Help
Entry
KO116_01770       CDS       T03800                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
hak  Halomonas sp. KO116
Pathway
hak00071  Fatty acid degradation
hak00280  Valine, leucine and isoleucine degradation
hak00281  Geraniol degradation
hak00362  Benzoate degradation
hak00592  alpha-Linolenic acid metabolism
hak01100  Metabolic pathways
hak01110  Biosynthesis of secondary metabolites
hak01120  Microbial metabolism in diverse environments
hak01130  Biosynthesis of antibiotics
hak01212  Fatty acid metabolism
Module
hak_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:hak00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KO116_01770
   00592 alpha-Linolenic acid metabolism
    KO116_01770
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KO116_01770
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    KO116_01770
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KO116_01770
   00642 Ethylbenzene degradation
    KO116_01770
Enzymes [BR:hak01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     KO116_01770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Ank_5
Motif
Other DBs
NCBI-ProteinID: AJY50255
UniProt: A0A0D5M224
LinkDB All DBs
Position
1902804..1903982
Genome map
AA seq 392 aa AA seqDB search
MSLSPRDIVVVDGVRTAMAKAKNGAFRNVRAENLSAAAMQALFTRNPNLDPSEVDDVIWG
CVNQTLEQSMNIARNAAIMTGIPRSVPAQTVNRLCGSSMTALHIAAANIKAGMGDFFIIG
GVEHMEHVPMAHGVDVNPAASKYAAKAAMMMGLTAELLGKMHGVSREEQDKFGVRSHQRA
QAAMEKGYFDNEIIGVEGHDQRGFRVMVQRDEVIRPDSTLESMASLKPVFDPRNGTVTAG
TSSALSVGASAMAVMSYERAQALGLEPIARVLSTGVAGCDASIMGYGPVPASKKALKAAG
LSAADIQTVELNEAFAAQGIPVLKDLGFLDALDDKVNLNGGAIALGHPLGCSGSRICTTL
LNVMQQRDTTLGLATMCIGMGQGVATVFERLK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgagtccgagagatattgtggtggttgacggtgtccgtaccgccatggcgaaa
gccaagaatggtgcttttcgtaacgttcgcgctgagaacctctctgctgcggccatgcag
gcgctgtttactcgtaacccaaacctagacccgtcggaagttgatgatgtgatctggggt
tgtgtgaatcagacgcttgagcaatcaatgaatattgcacgcaacgcggcgattatgacc
ggtattccccgttcggtacctgcgcaaacggtcaaccgtttgtgcggttcttcgatgact
gcgttgcatatcgctgcggccaatatcaaagcgggcatgggtgatttctttatcatcggt
ggcgtggagcatatggagcacgtacccatggcccacggcgttgacgtcaacccggcagcc
agcaaatacgcggccaaagcggcgatgatgatgggcttgaccgctgaactactgggcaaa
atgcacggcgtttcccgagaagagcaggacaagtttggcgtgcgttcccaccagcgtgct
caagcggcgatggagaagggctacttcgataatgaaattatcggtgttgaaggccacgat
cagcgcggcttcagggtgatggttcagcgcgatgaggttattcgccccgactctaccctg
gagtctatggcgagcctcaaaccggtatttgatccgcgcaacggtaccgtgaccgcaggt
acgtcctcggcgctttctgttggtgcctcggcaatggcagtgatgagttacgagcgtgct
caagcactgggcttagagcccatagcgcgagtgctttcgaccggtgtggcaggttgcgat
gcgtctatcatgggctatggtccagtgcctgcgtccaagaaagcgctaaaagccgctggt
ctctctgccgctgatatccaaacggttgagctcaacgaagcgtttgccgctcaggggatt
ccagtgctgaaagatttaggcttcctggatgcgctggacgataaggttaacctcaacggt
ggggccattgcccttgggcaccccttgggctgctcgggctcacgcatctgcaccacgctg
ttgaacgttatgcagcagcgcgatactaccctgggcttggcgaccatgtgtatcggcatg
ggacagggggttgcaacggtatttgaacggctgaaataa

DBGET integrated database retrieval system