KEGG   Halomonas sp. KO116: KO116_01912Help
Entry
KO116_01912       CDS       T03800                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
hak  Halomonas sp. KO116
Pathway
hak00550  Peptidoglycan biosynthesis
hak01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:hak00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KO116_01912
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    KO116_01912
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hak01011]
    KO116_01912
Enzymes [BR:hak01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     KO116_01912
Peptidoglycan biosynthesis and degradation proteins [BR:hak01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   KO116_01912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer SURF1
Motif
Other DBs
NCBI-ProteinID: AJY50395
UniProt: A0A0D5M2H0
LinkDB All DBs
Position
2048102..2050009
Genome map
AA seq 635 aa AA seqDB search
MLKRPNTLKNSEQELRIFRVRALLAVLVVLTLASLLTGRLIYLQIVQHDMYSTRSENNRV
RVEPLPPNRGLIYDRNGVLLAENRPTYNLTLVRERVDNLDETLALLVELLELPEEEIEAF
NVRSRQRQRPFQPALLTSDLSEDQIARLAVNRHRLPGVEIEAQPLRFYPDAEIMAHALGY
VGRINAEEMETLDAGRYAGTHFIGKTGIERFYEEELHGEAGLRKVETNARGRVLRELGRT
DPVPGKNLTLTLDKSLQMLAYELLDGRRGSIVAIVPATGEILAMVSTPGFDSNQFVTGID
VASYRGLQEDLDLPLFNRAIRGHYPPGSTIKPFLALAGLVEGVITPDSTINDPGYYQLPN
DSRRYRNWLRWGHGRVDMERSLAVSNNTYYYTLAHDLGIDNLHEQMSNFGFGQRVAHDVQ
GESSALMPSRDWKRGRFNQPWYPGETLSVGIGQGYWQVTPLQLASATATLANRGHWVKPR
LARQIGDTPVPRDLPDTLDDIQLANDNWWNRVFSGMEKVISGTEGTARRTGVGLEYRMGG
KSGTAQVFSLGQDQRYNADELAERLRDHALFMAFAPLEDPQIAVSVIVENAGGGSTHAAH
LARAMTDAWLLEDEAPDAEEVREVLEEDNANVEGN
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagcgccccaacacgctaaaaaactccgagcaagaactgcgtatttttcgtgtt
agagcgctgctcgccgtgttggtggtattgacccttgccagcttgctaacggggcggctt
atttatttacagatcgtccagcacgacatgtatagcacgcgctctgaaaataaccgggtt
cgcgtcgaaccgctgccgcctaaccgggggttaatttacgatcgtaatggcgtactgtta
gctgaaaaccgtccaacctataacctgaccctcgttcgcgagcgcgtcgataatctggat
gaaacgctggcgttgctggtagagcttcttgagttgcctgaagaagagattgaagcgttt
aacgtgcgctcacgccagcgccagcgacctttccaaccagcgctgcttaccagtgatcta
agtgaagaccaaattgcccgtttggcagttaaccgccaccgcctaccaggggtggagata
gaggctcagccgctgcggttttatcctgatgccgagataatggcccatgcgctaggttac
gttggccgcattaatgctgaagagatggaaacgctggatgcaggtcgttacgccggtact
cactttatcggtaaaaccggtattgaacgtttttacgaagaagagcttcatggtgaggcg
ggtttacgcaaagtggaaacgaacgcccgcggaagagtattacgagaactagggcgcact
gacccggtacctgggaagaatttgacattaacgctggataagtcgctccagatgctggct
tatgaactgttagatggccgtcgcggttctatcgtcgctatcgtgccagccacaggtgag
attcttgctatggtctcgacgccggggtttgacagtaatcagtttgtcaccggcattgat
gtggcttcttatcgtggtttgcaggaggatctcgatttaccgctctttaatcgcgctatc
cgcggccattatcctcctggctctaccattaagccctttctagcgctggccgggttggtg
gagggcgtcattaccccggatagcacgattaatgatcctggttattatcagttacctaac
gactcccggcgttaccgcaactggttgcgctgggggcatggccgtgtcgatatggagcgt
tccctagccgtttccaataacacttactactacaccttggcacatgatttaggcatcgat
aatctccatgaacagatgagtaattttggctttggtcagcgtgtggcccatgacgtacaa
ggagaaagcagcgctttgatgccctcacgtgattggaaacgaggacgctttaaccagccc
tggtatcccggtgagaccctatccgtggggattgggcaaggctactggcaggtgacgcct
ttgcagttagccagtgccactgccacgctggccaatcgcggccactgggtgaaacctcgc
ttggcacgccagattggcgatacccctgtcccccgcgacctgcccgataccttggatgac
attcagttagccaatgataactggtggaatcgagtattcagcggtatggagaaggtgatt
agtggcaccgaagggaccgcgcgtcgaactggcgtgggccttgagtatcgcatgggcggt
aagtcaggcacggcacaggtgttttcgctgggtcaggatcaacgttataacgctgatgag
ttagcggagcggttacgtgaccacgcgctgtttatggccttcgcgccactggaagatcct
cagattgcggtatccgttattgttgaaaacgcaggcggcggcagtacgcatgcggctcat
ttggcgcgcgctatgacggatgcctggttactcgaggatgaggcgccggacgcagaagaa
gtacgcgaagtgttagaagaagataacgccaacgtggagggtaactaa

DBGET integrated database retrieval system